HOG Organism Gene ID Name Annotation
aHOG1109 hhi 155 HAH_0155 hypothetical protein
aHOG1109 hbo HBOR15910 Hbor_15910 conserved hypothetical protein, DprA/Smf-related, family 1
aHOG1109 hla HLAC0814 Hlac_814 hypothetical protein
aHOG1109 hmu HMUK1012 Hmuk_1012 conserved hypothetical protein
aHOG1109 hut HUTA1965 Huta_1965 conserved hypothetical protein
aHOG1109 hwa HQ2000 hypothetical protein
aHOG1109 nph NP0552 hypothetical protein
aHOG1109 hma Hma_12888 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


2000|hp|hwa        MRISVVGGSTVTDDEYARAERLGEVVGERGHELICGGLGGVMEAVCKGAQNTG--AHTIG
15910|chp|hbo      MRVSIIGGSSVTDTVRETAAATGRIVAQRGHTVVCGGLGGVMESACRGAKAAG--GETIG
814|hp|hla         MRVSVIGGSSVPAETAAVAEELGERLANRGHTVVCGGLGGVMAAVCRGAANAG--GETIG
1965|chp|hut       MRVSVIGGSTVGDELYEQAREVGRLLAEHDHEVVCGGLGGVMEAAARGAKEAG--GHPIG
552|hp|nph         MRVSVIGGSSVGDESAAIAESVGQTLAEHGHTVVCGGLGGVMEAVCRGAHNAEPPAETIG
155|hp|hhi         MRVSVIGGSTVTDEQYQQAREVGKLLGEHGHDVVCGGLTGVMEAVCRGASEAG--GHTLG
12888|hp|hma       MRVSVIGGSTVTDEQYQQAREVGQLLGEHGHEVVCGGLTGVMEAVCRGASEAG--GHTIG
                   **:*::***:*       *   *  :.:..* ::**** *** :...**  :   . .:*

2000|hp|hwa        IIPGKDPKQANEYVETAIATGINDARNPVIVMNGDGVVAVDGGPGTLSEIGHALTFKKPV
15910|chp|hbo      ILPTDRRADANEYVDTPIATGLGHGRNALVVMNGDAVIAIDGAGGTLSEIGLSLVYDRPI
814|hp|hla         VLPTGRCEDANPHVTTPIATGMGHARNALVVMNGDAAIAVDGSHGTLSEIGMALAHGRAV
1965|chp|hut       ILPGEDREMANEYIETPIATGLGNARNALVVSNGDAAIAIDGSTGTLSEIALALDAGKPV
552|hp|nph         ILPGRDRTAANDWVTTPIATGLGNARNVVVVRNGDAVIAVDGAAGTLSELGHALDLGRPV
155|hp|hhi         ILPGERRADANDYVQTAIATGMGNARNVLVVMNGAAVIAVDGGTGTLSELGHALDINRPV
12888|hp|hma       ILPGERTAAANDYVQTAIATGLGNARNVLVVMNGAAVIAVDGGTGTLSELGHALDIDRPV
                   ::*      **  : *.****:. .** ::* ** ..:*:**. *****:. :*   ..:

2000|hp|hwa        AGLDTHRVNGVY---GIEHIEVPIEAVRYLEDSIES-
15910|chp|hbo      AGLGTHEVD------GIEACETPEETVKYVETES---
814|hp|hla         AGLDTHDIE------GVEAVASPARAIDHVENAV---
1965|chp|hut       GGLDTHDIE------GVEAVETPEAAVEYVESARLS-
552|hp|nph         AGLRTHDIE----LDGFQPVETPTEAVEYVERAVGSR
155|hp|hhi         AGLGTHRLDGVADGDAIEHVDTPAEAVAYVESAVQ--
12888|hp|hma       AGLGTHRFDSPV-GDAIEHVDTPAEAVAYVESAVQ--
                   .** ** .:      ..:    *  :: ::*