HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0011COG1222KOG0729 KOG0651 KOG0652 KOG0726 KOG0727 KOG0728arCOG01306ATP-dependent 26S proteasome regulatory subunitATP-dependent 26S proteinase regulatory subunit 4 homolog

HOG Organism Gene ID Name Annotation
cHOG0011 nrc1 VNG0510 prrIV2 ATP-dependent 26S proteinase regulatory subunit 4 homolog
cHOG0011 nrc1 VNG2000 prrIV1 ATP-dependent 26S proteinase regulatory subunit 4 homolog
cHOG0011 hmu HMUK2902 Hmuk_2902 26S proteasome subunit P45 family
cHOG0011 hmu HMUK1307 Hmuk_1307 26S proteasome subunit P45 family
cHOG0011 hma RRNAC3190 pan1 proteasome-activating nucleotidase
cHOG0011 hma RRNAC3546 pan2 proteasome-activating nucleotidase
cHOG0011 hwa HQ1544A pan2 proteasome-activating nucleotidase
cHOG0011 hwa HQ3115A pan1 proteasome-activating nucleotidase
cHOG0011 hla HLAC0185 Hlac_185 26S proteasome subunit P45 family
cHOG0011 hla HLAC2011 Hlac_2011 26S proteasome subunit P45 family
cHOG0011 hbo HBOR23690 Hbor_23690 Proteasome-activating nucleotidase
cHOG0011 hbo HBOR05530 Hbor_05530 Proteasome-activating nucleotidase
cHOG0011 hut HUTA0368 Huta_0368 26S proteasome subunit P45 family
cHOG0011 hut HUTA1160 Huta_1160 26S proteasome subunit P45 family
cHOG0011 hvo HVO_0850 HVO_0850 panA proteasome-activating nucleotidase A
cHOG0011 nph NP1524A pan_2 proteasome-activating nucleotidase
cHOG0011 nph NP5038A pan_1 proteasome-activating nucleotidase
cHOG0011 hhi 759 pan2 proteasome-activating nucleotidase
cHOG0011 hhi 453 pan1 proteasome-activating nucleotidase
MUSCLE (3.6) multiple sequence alignment


510|gene|nrc1       -----------------------------------------MRDRLLDANAENNKYQQKL
185|gene|hla        --MTDTVDDVELPYDEGSASRQEKIESLQEELDVLESQNEEMRDKLLDANAENNKYQQKL
1544|gene|hwa       --MSDTVNDVDLPYDEETASQQEKIQALRERLDILESQNEEMRDKLLDANAENNKYQQKL
23690|gene|hbo      --MTDTVDDVDLPYDEDAASQQEKIQALQERLDILESQNEEMRDKLLDANAENNKYQQKL
1524|gene|nph       --MTDTVDDVDLPYED-GASQQEKLEALEERLEILEQQNEEMRDKLLDANAENNKYQQKL
368|gene|hut        --MTDTVDDVDQPYDD-DVSKQEKIEALEEQLDLLESQNEEMRDELLDANAENNKYKQKL
13546|gene|hma      --MTDTVDEVDMPYDD-DASQQQKIEALQERLEVLESQNEEMRDKLLDANAENNKYQQKL
759|gene|hhi        --MTDTVDEVDMPYDD-DASQQQKIEALQERLEVLESQNEEMRDKLLDANAENNKYQQKL
5038|gene|nph       MSHSPSLPDRPTLNLDPEMSEAERLAALRNHFIEVSQVHEELADQLEDARERQSELHEEV
1160|gene|hut       MSRSPSLPDRPTLDLDPEMSPSERLAALEEHYAKVVRVNEQLQQKLDAAQETQRSLVEDV
13190|gene|hma      MSRSPSLPERPRLELDPDMTPDERLEALREHFKEIVQVNEQLTEQLDAARDRQHDLTDEV
453|gene|hhi        ------------MELDPDMTPDERLEALREHFKEIVQVNEQLTEQLDAARDRQHDLTDEV
2000|gene|nrc1      MSRSPSLPDRPTLDVDPESTPAERLNALQDHYVDIVAVNGELQAQLDDVEARREELREEV
2011|gene|hla       MSHSPSLPDRPRLELDPEMSETERLEAIRQHYRRILQVNDELEDRLDDAQDRRGELKSDV
3115|gene|hwa       MSRSPSLPERPRLDLDPEMSDAERLSAIRKHYERLLTVNEELDERLTDATETQSELQSEV
5530|gene|hbo       MSRSPSLPERPRLDLDPEMSDAERLSALRQHFERLREVNRELDDRLTEATDRRDDLQSEV
                                                             :   *  .   . .  ..:

510|gene|nrc1       ERLSHENKKLKQSPLFIATVQELTDEG-AVIKQHGNNQEALTEVTDELRATLEPGSRVAV
185|gene|hla        ERLTHENKKLKQSPLFVATVQEITPDG-AVIKQHGNNQEALTEITAEMREKLNPDDRVAV
1544|gene|hwa       ERLTHENKKLKQSPLFVATVQEITNNG-IVIKQHGNNQEALTEVTDEMRTELEPDTRVAV
23690|gene|hbo      ERLTHENKKLKQSPLFVATVQEITDEG-VIIKQHGNNQEALTEVTDELREDLEPDSRVAV
1524|gene|nph       ERLTHENKKLKQSPLFVATVQELTGEG-VIIKQHGNNQEALTEVTDDMREDLAPDDRVAV
368|gene|hut        ERLTHENKKLKQSPLFVATVQELTEDG-VVIKQHGNNQEALTEVTEEMREDLEPDDRVAV
13546|gene|hma      ERLTHENKKLKQSPLFVATVQELSSDG-VIIKQHGNNQEALTEVTDEMREELEPDDRVAV
759|gene|hhi        ERLTHENKKLKQSPLFVATVQELSSDG-VIIKQHGNNQEALTEVTDEMREDLEPDDRVAV
5038|gene|nph       SELQAENEALKTSSLYLATVEELTDDQ-VLLKQHGNNQEVITDVSPRLYNQLEAGDRVAI
1160|gene|hut       DTLERENQALKTASLYIATAEEVTDDG-VIVRQHGNNQEVLTELPSGLVDEVEAGDRVAI
13190|gene|hma      DQLERENETLKTSSLYIATAEELTDDG-VVVKQHGNNQEVLTEVSPSIRDGLEAGDRVAI
453|gene|hhi        DQLERENETLKTSSLYIATAEELTDDG-VVVKQHGNNQEVLTEVSPSIRDGLEAGDRVAI
2000|gene|nrc1      NRLQRENETLKTASLYLATVEDLPEDGSAVIKQHGNNQEVLTELSPRLADTLEVGDRVAI
2011|gene|hla       DGLKRENEVLKTTSLYIASVEEITDDG-VVIKQHGNNQEVLTQASTTLESDLRPGDRVAN
3115|gene|hwa       DKLKRRNETLKTSSLYLASVEELTDNGEVVIKQHGNNQEVLTELSSRLDGDLEAGDRVAI
5530|gene|hbo       DQLKRRNETLKTSSLYIATVEEVTDDG-VVIKQHGNNQEVLTDTSPHLESQVEAGDRVAI
                    . *   *: ** :.*::*:.:::. :   ::.*******.:*: .  :   :  . *** 

510|gene|nrc1       NNSLSVVRQLDDEADVRARVMEVDDSPDVGYEDIGGLDDQLREVRETVELPMKDPGLFET
185|gene|hla        NNSLSVVKKLEKETDVRARVMQVEHSPDVTYADIGGLEEQMQEVRETVEMPLEHPDMFED
1544|gene|hwa       NNSLSVVKRLDDETDVRARVMQVEHSPSIRYDDIGGLETQMQEVRETVEMPLKSPEMFET
23690|gene|hbo      NNSLSIVKRLDNETDVRARVMQVEHSPDVSYADIGGLEQQMQEVRETVEMPLESPEMFDQ
1524|gene|nph       NNSLSIVKRLDSETDVRARVMQVDESPDVSYEDIGGIDDQMEEVRETVEMPIESPEMFDE
368|gene|hut        NNSLSIVKTLEDETDVRARVMQVDQSPDVTYQDIGGLDDQVSEVRETVEMPLKSPEMFDE
13546|gene|hma      NNSLSIVKQLDDETDVRARVMQVDQSPDVTFADIGGIEEQMEEVRETVEMPLKSPEMFED
759|gene|hhi        NNSLSIVKQLDDETDVRARVMQVDQSPDVTFADIGGIEEQMEEVRETVEMPLKSPEMFED
5038|gene|nph       NDSFAIQTVLDAETDARAQAMEISERPDVGYADIGGLDEQIREVREAVEDPLTNPGKFEE
1160|gene|hut       NDSFNLKATLSAETDSRAQAMQVDGSPEVTYDDIGGLEAQIREVREAVEEPLLNAEQFRE
13190|gene|hma      NDSFGVKQILDPETDARAQAMQVDGSPDVSYSDIGGLEEQIREVREAVEEPLVNAEQFRE
453|gene|hhi        NDSFGVKQILDPETDARAQAMQVDGSPDVSYSDIGGLEEQIREVREAVEEPLVNAEQFRE
2000|gene|nrc1      NDSFSVQRVLDDETDARAQAMEVDESPSVTYADIGGLDDQLREVREAVEDPLVNPEKFDA
2011|gene|hla       NDSFAVQQVLDDETDSRAQAMEVTESPDVTYDDIGGIDDQIREVREAVEDPLEDPEQFEA
3115|gene|hwa       NDSFAIQQVLDDETDARAQAMEIDASPQVTYTDIGGIDDQVREVREAVEDPLTNPALFEE
5530|gene|hbo       NDSFAIQTVLDDETDARAQAMEVDASPDVTYDDIGGIDDQVREVREAVEDPLSNPEMFAK
                    *:*: :   *. *:* **..*::   *.: : ****:: *: ****:** *:  .  *  

510|gene|nrc1       VGINPPSGVLLHGPPGTGKTLMAKAVASQTDASFIKMAGSELVHKFIGEGAKLVRDLFQV
185|gene|hla        VGITPPSGVLLYGPPGTGKTMLAKAVANETDATFIKMAGSELVHKFIGEGAKLVRDLFEV
1544|gene|hwa       VGIQPPSGVLLYGPPGTGKTMLAKAVANQTDASFIKMAGSELVHKFIGEGAKLVRDLFEV
23690|gene|hbo      VGIQPPSGVLLYGPPGTGKTMLAKAVANQTNASFIKMAGSELVHKFIGEGAKLVRDLFEV
1524|gene|nph       VGIDPPSGVLLHGPPGTGKTMLAKAVANQTDATFIKMAGSELVHKFIGEGAKLVRDLFEL
368|gene|hut        VGIDPPSGVLLHGPPGTGKTMLAKAVANQTDATFIKMAGSELVHKFIGEGAKLVRDLFEL
13546|gene|hma      VGIDPPSGVLLHGPPGTGKTMLAKAVANETDATFIKMAGSELVHKFIGEGAKLVRDLFEL
759|gene|hhi        VGIDPPSGVLLHGPPGTGKTMLAKAVANETDATFIKMAGSELVHKFIGEGAKLVRDLFEL
5038|gene|nph       VGIEPPTGVLLHGPPGTGKTMLAKAVANQTDATFIKMAGSELVQKFIGEGARLVRDLFEL
1160|gene|hut       VGIDPPSGVLLHGPPGTGKTMLAKAVANQTDATFIKMAGSELVRKFIGEGAKLVRDLFEL
13190|gene|hma      VGIEPPSGVLLHGPPGTGKTMLAKAVANETDATFIKMAGSELVRKFIGEGARLVRDLFEL
453|gene|hhi        VGIEPPSGVLLHGSPGTGKTMLAKAVANETDATFIKMAGSELVRKFIGEGARLVRDLFEL
2000|gene|nrc1      VGVEPPSGVLLHGPPGTGKTMLAKAVANQTDASFIKMAGSELVRKFIGEGSRLVRDLFEL
2011|gene|hla       VGVDPPSGVLLHGPPGTGKTMLAKAVANESDATFIKMAGSELVRKFIGEGARLVRDLFEL
3115|gene|hwa       VGVEPPSGVLLHGPPGTGKTMLAKAVANETDATFIKMAGSELVRKFIGEGSRLVRDLFDL
5530|gene|hbo       VGVEPPSGVLLHGPPGTGKTMLAKAVANETDATFIKMAGSELVRKFIGEGARLVRDLFEL
                    **: **:****:*.******::*****.:::*:**********.******:.******::

510|gene|nrc1       ARDHEPAVVFIDEIDAIASKRTDSKTSGDAEVQRTMMQLLSEMDGFDERGDIRIIAATNR
185|gene|hla        ARENQPAVLFIDEIDAIASKRTDSKTSGDAEVQRTMMQLLSEMDGFDERGEVRIIAATNR
1544|gene|hwa       ARENEPAVIFIDEIDAIASKRTDSKTSGDAEVQRTMMQLLSEMDGFDERGDVRIIAATNR
23690|gene|hbo      ARENEPAVIFIDEIDAIASKRTDSKTSGDAEVQRTMMQLLSEMDGFEERGDIRIIAATNR
1524|gene|nph       ARQEVPAVVFIDEIDAIAAKRTESKTSGDAEVQRTMMQLLAEMDGFEDRGQISIIAATNR
368|gene|hut        ARQHEPSVLFIDEIDAIAAKRTDSKTSGDAEVQRTMMQLLSEMDGFDERGEIRIIAATNR
13546|gene|hma      ARQEEPAVVFIDEIDAIAAKRTESKTSGDAEVQRTMMQLLSEMDGFDDRGDIRIIAATNR
759|gene|hhi        ARQEEPAVVFIDEIDAIAAKRTESKTSGDAEVQRTMMQLLSEMDGFDDRGDIRIIAATNR
5038|gene|nph       AAEREPAIIFIDEIDAIAAKRTESKTSGDAEVQRTMMQLLSEMDGFDRRGDISIIAATNR
1160|gene|hut       AAEREPAIIFIDEIDALASKRTDSKTSGDAEVQRTMMQLLSEMDGFDDRGEIRIIAATNR
13190|gene|hma      AAEREPAIIFIDEIDAIAAKRTESKTSGDAEVQRTMMQLLSEMDGFDERGEIRIIAATNR
453|gene|hhi        AAEREPAIIFIDEIDAIAAKRTESKTSGDAEVQRTMMQLLSEMDGFDERGEIRIIAATNR
2000|gene|nrc1      AEQKDPAIIFIDEIDAVAAKRTDSKTSGDAEVQRTMMQLLSEMDGFDERGDIRIIAATNR
2011|gene|hla       AGEREPAVIFIDEIDAVAAKRTDSKTSGDAEVQRTMMQLLSEMDGFDDRGEVRIMAATNR
3115|gene|hwa       AAEREPAVIFIDEIDAVASKRTDSKTSGDAEVQRTMMQLLSEMDGFDERGEIRIIAATNR
5530|gene|hbo       AADREPAVIFIDEIDAVASKRTDSKTSGDAEVQRTMMQLLSEMDGFDDRGEIRIMAATNR
                    * :  *:::*******:*:***:*****************:*****: **:: *:*****

510|gene|nrc1       FDMLDRAILRPGRFDRLIEVPHPNVGGREKIFRIHTRAMNVADSVDFGELAADTGDLSGA
185|gene|hla        FDMLDPAILRPGRFDRLIEVPKPNTEGREIIFQIHTRKMNLASDINFDELAEMTPDASGA
1544|gene|hwa       FDMLDEAILRPGRFDRLIEVPKPGIEGRKIIFQIHTREMNVSDNVEFEQLAEMADDASGA
23690|gene|hbo      FDMLDPAILRPGRFDRLIEVPKPDVEGREIIFQIHTRNMNVADDVDFHQLAEMADEASGA
1524|gene|nph       FDMLDRAILRPGRFDRLIEVPKPDFEGREIIFDIHTRDMNVADGVDYTELAEMADNASGA
368|gene|hut        FDMLDRAILRPGRFDRLIEVPKPDETGREQIFKIHTRGMNLAETVDFESLAAEATDASGA
13546|gene|hma      FDMLDRAILRPGRFDRLIEVPNPDLEGRKQIFQIHTRSMNVADDVDFEALAEDIQDASGA
759|gene|hhi        FDMLDRAILRPGRFDRLIEVPNPDVEGRKQIFQIHTRSMNVSDDVEFEALAEEITDASGA
5038|gene|nph       FDMLDRAILRPGRFDRLIEVPEPDIEGRTQILQIHSRGMQLDSAIDLAAIAEETEGFSGA
1160|gene|hut       FDMLDRAILRPGRFDRLIEVPEPDVEGRERILEIHTREMNLADSVDLGTIAAETEGMTGA
13190|gene|hma      FDMLDRAILRPGRFDRLIEVPNPDVEGRERILEIHTQEMNLDDDVDLGAFATETDGLSGA
453|gene|hhi        FDMLDRAILRPGRFDRLIEVPNPDVEGRERILEIHTQEMNLDDDVDLGAFATETDGLSGA
2000|gene|nrc1      FDMLDSAILRPGRFDRLIEVPNPNPDARERILEIHAGEMNVADSVDFSDLAADTAEFSGA
2011|gene|hla       FDMLDEAILRPGRFDRLIEVPEPNAEGRARILEIHTQDMNVAEGTDVSEVAADLEGYSGA
3115|gene|hwa       FDMLDEAILRPGRFDRLIEVPKPGHEGREQILEIHTRDMNVADDVDFGELVSDIDEYSGA
5530|gene|hbo       FDMLDEAILRPGRFDRLIEVPNPDPEGIVKILEIHTREMNIADDVDFEELAEELDGQSGA
                    ***** *************** *.  .   *: **:  *:: .  :   ..      :**

510|gene|nrc1       DVKAICTEAGMFAIRDDRTEVRMQDFQSAREKLDQDSEPAAATDVSRTFA---
185|gene|hla        DIKAICTEAGMFAIRDDRTEVTLDDFLGAHEKLQQDDETGA--DDSLAFA---
1544|gene|hwa       DIKAICTEAGMFAIREDRTEIGMGDFIEAWEKIQSESNTDG--DTARAFA---
23690|gene|hbo      DVKAICTEAGMFAIRDDRTEIYMGDFVSAWEKIQAEADDDA--DVSRAFA---
1524|gene|nph       DIKAICTEAGMYAIRDDRTEVRHEDFEQAWRKIQETEEADA--DVSKTFA---
368|gene|hut        EIKAICTEAGMFAIRDDRTEVTEADFRDAWEKIQAEESDDE---VSKTFA---
13546|gene|hma      DVKAICTEAGMFAIRDDRTEVTMADFHNAWEKIQQEETDDE--DVSRTFA---
759|gene|hhi        DVKAICTEAGMFAIRDDRTEVTMADFHNAWEKIQQEETDDE--DVSRTFA---
5038|gene|nph       ELESLTTEAGMFAIRDGRTEVRREDFDDALEKI--AEDDAA--GTPIAFY---
1160|gene|hut       EIESLTTEAGMFAIRDTRTEVTEADFEDAIEKVREADEDSV--GTPVMFQ---
13190|gene|hma      ELASLATEAGMFAIRDGRTTVQQADLHDALEKIEADDDASS---VPVAFA---
453|gene|hhi        ELASLATEAGMFAIRDGRTTVKQSDLHDAYEKIEADDDASS---VPVAFA---
2000|gene|nrc1      QLASLATEAGMFAIRDDRDEVHRQDFDDAYEKLVAEGDTES--SGPRYPSYIQ
2011|gene|hla       DIASLATEAGMFAIRDGRTEVTQADFEQAREKLQDAEKTEE--QVINYQY---
3115|gene|hwa       DLASLATEAGMFAIRDDRTEVRRSDFDDAHEKLEDSDTQTTIPGPTTYQY---
5530|gene|hbo       DIASLTTEAGMFAIRDDRTEVRRVDFDDAIEKMRDAEDSRSIPGHTDYQY---
                    :: :: *****:***: *  :   *:  *  *: