HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0108COG0147KOG1223arCOG02014Anthranilate/para-aminobenzoate synthases component Ianthranilate synthase alpha chain

HOG Organism Gene ID Name Annotation
cHOG0108 nrc1 VNG0384 trpE2 anthranilate synthase alpha chain
cHOG0108 hmu HMUK2930 Hmuk_2930 para-aminobenzoate synthase component I( EC:4.1.3.27 )
cHOG0108 hma RRNAC0709 trpE1 anthranilate synthase component I
cHOG0108 hma PNG7327b trpE3 anthranilate synthase component I
cHOG0108 hwa HQ1784A trpE anthranilate synthase, component I
cHOG0108 hla HLAC0459 Hlac_459 Chorismate binding-like protein
cHOG0108 hbo HBOR25060 Hbor_25060 aminodeoxychorismate synthase, subunit I( EC:4.1.3.27 )
cHOG0108 hut HUTA2480 Huta_2480 para-aminobenzoate synthase component I
cHOG0108 hvo HVO_0710 HVO_0710 pabB para-aminobenzoate synthase component I
cHOG0108 nph NP0802A trpE_2 anthranilate synthase, component I 2
cHOG0108 hhi 1357 trpE1 anthranilate synthase component I
cHOG0108 hhi 5226 trpE3 anthranilate synthase component I
MUSCLE (3.6) multiple sequence alignment


384|gene|nrc1       -------------------MPDSAALATDPAAFRDAAGDATAPTRAVVEARLPVTDPFAA
2480|gene|hut       --------------------MTDPELVTDLATFRARAAGADPGDRVPVEARVTVTDPYEA
1784|gene|hwa       --------------------MHEVTVVTDEATFTETAAQAPAGARVPIEIEFTTEDPFTA
459|gene|hla        ---------------------MQRWVHTDRDRFREVAAAAPAGARVPVERRVAVDDPFAA
7327|gene|hma       MLGLHNHTGRQGLSLRSNCTMTEIRFSTDKESFIETARAAADGTRVPVEARVTVADPFEA
5226|gene|hhi       --------------------MSEIRFSTDRESFIETARTAADGARVPVEARVTVPDPFEA
25060|gene|hbo      -----------------MTNSLTPTVETRREAFLATAADASAGARVPVELRVRVSDPFDA
802|gene|nph        -----------------------MRVVTDRASFRSAAADAPDSARVPVELRVTVADPFEA
10709|gene|hma      ----------------------MQSVETDRTTFTDLAADAHPAARVPVEVRVDVDDPFLA
1357|gene|hhi       ----------------------MQSVETDRTTFTDLAADAHPAARVPVEVRVDVDDPFLA
                                             . *    *   *  *    *. :*  . . **: *

384|gene|nrc1       YRRARGDAPS-FHYETTGGSDGWGYFGVDPASMLRADGAG--------------------
2480|gene|hut       YRRARRSTGG-CVLETTGGTEGWSYFGVEPIEWLTVDPGED-------------------
1784|gene|hwa       YRRARTDTDDGIYLETTGGQSGWGYFAIDPVERIQVTGSAASIGQHPPQQESMAERGDEG
459|gene|hla        YRRARDGPGG-FFYETTGGQSGWGYFGVDPVERLTVSGDAVV--------------ASEG
7327|gene|hma       YRRARDENTDGFYLETTGGQSGWGYFGIEPIERVEVSAGATP--------------AQDG
5226|gene|hhi       YRRARDGNTDGFYLETTGGQSGWGYFGVDPVEQIEVSASATP--------------AQDG
25060|gene|hbo      YRRARDEGGDGFFLETTGGQSGWSYFGMDPVERLCVGSDAET--------------LAAA
802|gene|nph        YRRARDGDGGDIYLETTGGQSGWGYFATDPRERTTVRASAV---------------ASDG
10709|gene|hma      YRRARDETGG-VYLATTGGQSGWGYFGTAPADFREVDPRA--------------------
1357|gene|hhi       YRRARDETGG-VYLATTGGQSGWGYFGTAPADFREVDPRA--------------------
                    *****    .     **** .**.**.  * .   .                        

384|gene|nrc1       ------------ALDTVQAAV-GARLARV--GCDVPHPGGLFGWLSYDIARELEAIPDT-
2480|gene|hut       ------------TIGRLVDRLGEEHLHRA--GADVPYPCGAIGWLSYDIAREIEALPGS-
1784|gene|hwa       SQGRGP------SLDELDSILDRETLTRG--GCTVPYPCGAFGWLSYDVARELESIPQ--
459|gene|hla        SRSSGDYRRPSPTLAALEGVIDGEALARG--DCDVPYPCGAFGWLSYDAARELESFPESA
7327|gene|hma       ---GSP------SLEAIDDLLDREHLERG--DCTVPYPCGAFGWLSYDVARELEDIPET-
5226|gene|hhi       ---GSP------SIETIDELLDREHLERG--DCTVPYPCGAFGWLSYDVARELEDIPET-
25060|gene|hbo      DTGRGPNANTSSSLSTLDAALESESLVRGETGVEVPYPCGLFGWFSYDVARELESLPEL-
802|gene|nph        ---ESP------SLEAVDSLLEGTTLERG--GCDVPYPCGVFGWLSYDIARELESLPDD-
10709|gene|hma      ----GG------TLAALTEFLDGERLVRG--DCDVPYPCGAVGWLSYDVARELESLPDS-
1357|gene|hhi       ----GG------TLAALTEFLDGERLVRG--DCDVPYPCGAVGWLSYDVARELESLPDS-
                                ::  :   :    * *   .  **:* * .**:*** ***:* :*   

384|gene|nrc1       -----TTDARGLPRLQLGVYPTIAAWREP--------FTPGDDLRLIAAVP--------V
2480|gene|hut       -----AERDRDLPRLQVAVYDTLVAWEEP---------AQAPVTLRVTACPTV-------
1784|gene|hwa       -----TTPPSDLPRVQIGVFDRVAAWEEP--------RSDGSVTMHITACPVI------E
459|gene|hla        PAGPGAVDDRGLPRLQIGVFDRVAAWECPVSAGGDDSRDSAASTLRVTACPRVPEGLDDP
7327|gene|hma       -----TVSD-GLPRLQFGVFDCIAAWEEP--------HD-GNVEIHVTACPTV-------
5226|gene|hhi       -----TVSD-GLPRLQFGVFDCIAAWEEP--------HD-GDVEIHVTACPTV-------
25060|gene|hbo      -----ADDDRNLPHLRLGLFDRVAAWEEP--------RGDEPATLHVTACPRVPAGADST
802|gene|nph        -----TRDDRGLPRLQVATYDRVAAWEEP--------RS-EETTLRVTACPKV------G
10709|gene|hma      -----ADADRALPNLQVARYDRFAAWEEP--------RG-ESVTLRVTACPRV------D
1357|gene|hhi       -----ADADRALPNLQVARYDRFAAWEEP--------RG-ESVTLRVTACPRV------D
                         :     **.:... :  ..**  *                 ::* *         

384|gene|nrc1       DEYT--PDGAFEAGRDRVQSLAAAIRDGDPAVGPPP---ADSPAPFESVAGRAAFESRVR
2480|gene|hut       -DGD--PDAAFERGRERALELAGRAIDGDPGVEEPP---ATGPVRFESDTGREAFTDRVE
1784|gene|hwa       ADTN--IGYVYERGLAHARDLVSRIDTGTTSVDEPSVSAANNAITFKSECGTAAFEDRVR
459|gene|hla        DADRDALDALFDEGASRADDLIDRIESGNPAVGPAPDP-DASTATFESDVGREGYAEAVS
7327|gene|hma       -DGS--PESAFERGRTMARELAQDAIHGEKHVQSQPT--AASQATFESECGEAAFADRVR
5226|gene|hhi       -DGS--AESAFERGRTMARELAQDAIHGEKHVQSQPT--AASQATFESECGEAAFADRVR
25060|gene|hbo      DDDR--LDALYERAIERATDLAERAVSGDPSDEAAPV--AGDEAHFESDCGRAAFRDRVS
802|gene|nph        AYDS--MSAAYEHGVERARDLIAKATNGDPSVGQPPV--SGTEATFESDCTRAAFADRVR
10709|gene|hma      DFET--PELAYEFGKQHALDLARAAAQGDPSVEDPPV--ETDEATFESDCTRESFADRVQ
1357|gene|hhi       DFET--PELAYEFGKQHALDLARAAVQGDPAVGDPPV--EADEATFESDCTPEAFADRVQ
                              :: .   . .*      *       .         *:*     .: . * 

384|gene|nrc1       RIQDAIRDGDTFQANVSHRLDAPAAVHPVAVFEALRDTNPAPYSGIVEF-----------
2480|gene|hut       RVKEYVHEGDTFQANISHRLAAPAAVHPVEAFQSLRIGNPAPYSALLEF-----------
1784|gene|hwa       QIKEYIRDGDTFQTNVSHRLSAPAAIHPVTTFDALREVNPAPYSGLIEF-----------
459|gene|hla        RVKASIRDGDTFQANVSQRLRAPAAVHPVEAYDALRTVNPAPYSGLIEFSREGGAEGDND
7327|gene|hma       QIKQYVRDGDTFQTNVSHRLTAPAAVHPVDTFDAVRRVNPAPYSALLEF-----------
5226|gene|hhi       QIKQYVRDGDTFQTNVSHRLTAPAAVHPVDTFDAVRRVNPAPYSALLEF-----------
25060|gene|hbo      AVKRYIRDGDTFQANVSQRLVAPAVVHPVAAYRALRQVNPAPYSGLVEF-----------
802|gene|nph        RVKSYIRDGETFQANISQRLSAPATVHPVSAYAALRRVNPAPYSALVEF-----------
10709|gene|hma      TVKQYIRDGDTFQANVSQRLRAPAAVHPVEAFDALRTVNPAPYSALLEF-----------
1357|gene|hhi       TVKQYIRDGDTFQANVSQRLRAPAAVHPVEAFDALRTVNPAPYSALLEF-----------
                     ::  :.:*:***:*:*:** ***.:*** .: ::*  ******.::**           

384|gene|nrc1       -----------------PGVDLVSASPELLLAR-----------------RGRELTTEPI
2480|gene|hut       -----------------PAADLVSASPELLLHR-----------------EADRLVTEPI
1784|gene|hwa       -----------------PGVDLVSASPELLLSV-----------------DGERVSTEPI
459|gene|hla        TDDNDDNGDNDDGDDAPSGVDLVSASPELLLERVPSGGAAEAGADRDEGEHGARLVTEPI
7327|gene|hma       -----------------PGVDLVSASPELLLDV-----------------DGDQLLTEPI
5226|gene|hhi       -----------------PGVDLVSASPELLLDV-----------------DGDQLLTEPI
25060|gene|hbo      -----------------PEADLVSASPELLVHV-----------------EGDRLVTEPI
802|gene|nph        -----------------PGVDLVSASPELLLDV-----------------DGDRLLTEPI
10709|gene|hma      -----------------PGVDLVSASPELLLHR-----------------DGDRIETEPI
1357|gene|hhi       -----------------PGVDLVSASPELLLHR-----------------DGDRIETEPI
                                     . .**********:                    .  : ****

384|gene|nrc1       AGTRPRGATPAEDDAARAALRADDKERAEHAMLVDLERNDLGKVSEYGSVAVPDYRRVDA
2480|gene|hut       AGTRPRGRTADADAGLERELRDDEKERAEHAMLVDLERNDLGKVSEYGSVDVEEYRRVDR
1784|gene|hwa       AGTRPRGETSADDINLETDLTEDSKERAEHAMLVDLERNDLGKICKYGTVDVSEYRRVDR
459|gene|hla        AGTRPRGETPEADADMEAELTGDEKERAEHAMLVDLERNDLGKVSRFGTVDVAEYRRVDR
7327|gene|hma       AGTRPRGATPSEDEDLEVDLCSDEKERAEHAMLVDLERNDLGKVSEYGSVDVAEYRRVDR
5226|gene|hhi       AGTRPRGATPSEDEDLEADLCSDEKERAEHAMLVDLERNDLGKVSEYGSVDVAEYRRVDR
25060|gene|hbo      AGTRPRGATEAEDDALERDLTSDEKERAEHAMLVDLERNDLGKVSEYGSVEVSEYRRVDR
802|gene|nph        AGTRPRGETQTEDERLEADLLGDEKERAEHAMLVDLERNDLGKVSEYGSVDVREYRRVDR
10709|gene|hma      AGTRPRGETPDADDRLETDLLDDEKERAEHAMLVDLERNDLGKVSKFGSVEVSDYRRVDR
1357|gene|hhi       AGTRPRGETPDADDRLEADLLDDGKERAEHAMLVDLERNDLGKVSKFGSVEVSDYRRVDR
                    ******* *   *      *  * *******************:. :*:* * :***** 

384|gene|nrc1       YSEVLHLVSEVTGRLRDSCSLRDAIAAVFPGGTITGAPKPRTMALIDTVEATRRGPYTGS
2480|gene|hut       YSEVMHLVSLVEGQLRDDQDLADAIRAVFPGGTITGAPKPRTMAIIDELEATRRGPYTGS
1784|gene|hwa       YSEVMHLVSLIEGQRQPQTQIADAVAAVFPGGTITGAPKPRTMELIDEVETTRRGPYTGS
459|gene|hla        YSEVMHLVSLIEGEARSDVGLADAVAACFPGGTITGAPKPRTMEIIDELEETRRGPYTGS
7327|gene|hma       YSEVMHLVSLIEGELRDAVSIADAVAAVFPGGTITGAPKPRTMEIIDEVERTRRGPYTGS
5226|gene|hhi       YSEVMHLVSLIEGELRDDVSIADAVAAVFPGGTITGAPKPRTMEIIDEVERTRRGPYTGS
25060|gene|hbo      YSEVMHLVSVVEGQRRPDVSVADAVAAVFPGGTITGAPKPRTMEIIEEVESTRRGPYTGS
802|gene|nph        YSEVMHLVSLAEGTRRADCSLADAVGAVFPGGTITGAPKPRTMEIIDEVETTRRGPYTGA
10709|gene|hma      YSEVMHLVSVVEGRLRDGASLQDAIAAVFPGGTITGAPKPRTMEIIDEVEATRRGPYTGS
1357|gene|hhi       YSEVMHLVSVVEGRLRDGASLQEAIAAVFPGGTITGAPKPRTMEIIDEVEATRRGPYTGS
                    ****:****   *  .    : :*: * *************** :*: :* ********:

384|gene|nrc1       LAAIGFDGDATLSITIRTLVRRAATYHLRVGAGIVHDSTPAAEYDETLAKARALVTALGD
2480|gene|hut       IGIFGFDDRATMNIVIRTLVRHGEQYHLRVGAGIVEDSVPDREYDETLDKARALVTAVDD
1784|gene|hwa       IGIFGFDDRAVLNITIRTLVRHGDEYRLRVGAGIVHDSVPDHEYQETLDKARGLVRAVDT
459|gene|hla        MLAAGFDGRATLNIVIRTLVRRAAEYHLRVGAGIVHDSEPDAEYEETLAKARALVTAVDE
7327|gene|hma       IGMFGFDDRATLNITIRTLVHYDDEYRLRVGSGIVHDSVPEAEYRETLDKARALVTAVDE
5226|gene|hhi       IGMFGFDDRATLNITIRTLVHYDGEYRLRVGSGIVHDSVPEAEYRETLDKARALVTAVDE
25060|gene|hbo      IAAFGFDDRATLNIVIRTLVHHDDEYHLRVGAGIVHDSDPDAEYDETMAKGRALVNAIDE
802|gene|nph        IGLFGFDERATLNIVIRTLVRQGDSYYLRVGAGIVDDSDPDAEYDETLDKGRALVTAIDE
10709|gene|hma      IGLFGFDGRATLNIVIRTLVRYAEEYHLRVGAGVVHDSDPDREYQETLDKGRALVNAVDE
1357|gene|hhi       IGLFGFDGRATLNIVIRTLVRYAEEYHLRVGAGIVHDSDPDSEYQETLDKGCALVNAVDE
                    :   ***  *.:.*.*****.    * ****:*:* ** *  ** **: *. .** *:. 

384|gene|nrc1       AGGIG----------------------RVADTTPDNS---------
2480|gene|hut       ALADGTDLSVVEPSRARDAG-------RLDAGEEGASGGPEEGEDG
1784|gene|hwa       ALGERGSLTVGTTGNTLDESAA-----KQGASIQSERDGIETGDSS
459|gene|hla        ALAA------------------------GGMAVEEGVDR-------
7327|gene|hma       ALGE-----------------------QGSFAVESETEPMEGMR--
5226|gene|hhi       ALGE-----------------------QGSFAVESETEPMEGMR--
25060|gene|hbo      ALAAEGHGMRVVERDDADNENGRDTDGRTDARTEDHK---------
802|gene|nph        ALAE-----------------------RATFTMEAAKR--------
10709|gene|hma      ALGR-----------------------RVDLAMEDQQ---------
1357|gene|hhi       ALGR-----------------------RVDLAMEDQQ---------
                    * .