HOG Organism Gene ID Name Annotation
aHOG1071 hhi 1452 cdc48c cell division control protein 48/AAA family ATPase
aHOG1071 hbo HBOR19030 Hbor_19030 AAA family ATPase, CDC48 subfamily
aHOG1071 hla HLAC2069 Hlac_2069 AAA ATPase central domain protein
aHOG1071 hmu HMUK2344 Hmuk_2344 Vesicle-fusing ATPase
aHOG1071 hut HUTA0001 Huta_0001 Vesicle-fusing ATPase
aHOG1071 hwa HQ2753 cdc48 AAA-type ATPase (transitional ATPase homolog)
aHOG1071 nph NP4184 AAA-type ATPase (transitional ATPase homolog)
aHOG1071 hma Hma_10807 cdc48c cell division control protein 48
MUSCLE (3.6) multiple sequence alignment


2069|gene|hla       MAGKGKGRVAGTERMNDTAGLRLTVRAAEKRDAGRGIARLPESSRKRLGLLSGDTVEIRG
19030|gene|hbo      --------------MADDEGLELTVRGAEKRDAGRGIARLPESARQRLGVLSGDTVVVEG
2753|gene|hwa       --------------MDKDNAISLTVRGAEKSDAGRGIARLPESARQQLGVLSGDTVLIIG
1|gene|hut          -------------MVDADAGISVSVKGAKKRDAGRGIARLPEAVRNRLGVLSGDPVCIEG
4184|gene|nph       ----------------MDRQVTLTVKGAEKRDAGRGVARLPEAARQQLGVLSGDTVVIDG
1452|gene|hhi       ------------MSGSTDAGVELTVEGANKRDAGRGIARLPESARTELGVLSGSPVIIEG
10807|gene|hma      ------------MSGSTEAGVELTVEGANKRDAGRGIARLPESARTELGVLSGSPVIIDG
                                        : ::* .*:* *****:*****: *  **:***..* : *

2069|gene|hla       ERTAVAKVWPGGADAPEGSVLIDADTRANAGVKVGDAVTVAAVDVEDADRIVLAAPAELA
19030|gene|hbo      SRETVAKVWPADGGTPDGVVLIDADTRANADAKIGETVHVRKVDVEDARSVTLSMPDDVA
2753|gene|hwa       SRETVAKVWPANGSVSESIVLVDADTRTNADVTIGDTVRIHPIGVDDARSVTLSMPPDVS
1|gene|hut          DRQTVAKVWPDDGT--GEYVRIDADTRSNADVTVGSEVSLRRASLQDAERVELR---PID
4184|gene|nph       ESPTVAKVWPGTGG--GETVRIDAETRANAGVTIGDTVTVEPVSIADADRVVV----ELP
1452|gene|hhi       DDRTVVKVWPADDD--GSFVRIDSDTRANAGVNIGDTVTVTSGSVSEATEIAVQSVEPIP
10807|gene|hma      DDMTVVKVWPADDD--GSFVRIDSDTRANAGVNIGDTVTVTSGSVSEATEIAVQPVEPMP
                    .  :*.****         * :*::**:**...:*. * :   .: :*  : :     : 

2069|gene|hla       DVDVSREVVERALARDLRDRPVTEGEAVHVERLGGIRFVVAETDPAGTVRVTSRTDVSVR
19030|gene|hbo      FSDDDRAV--ELIKRAIQDRPIQSGGQIRFESLSADPFVISETSPDGMVRVTSSTRLKL-
2753|gene|hwa       FADEDRAV--ELIKRALRDRPIQADGQIRFESVSDKPFVVTETRPEGQVRVTDTTTLRLT
1|gene|hut          GTIEGNGV--STIDDRLGNVPVRPGDRVTVPEVG--TFHVEDTDPDGTVRVVDGTTLTV-
4184|gene|nph       VSADDDLL--EAVATDLQDRPLRDGEAVRLERPG-VRARVVETDPGGTVRVTGETTIRVR
1452|gene|hhi       GSEDYE----SLVRKRLVDQIIQADERTHIEGLG--TFLVRKTSPSGPVRVTGTTAVTVL
10807|gene|hma      GSEDYE----SLVRKRLVDQIIQADERTHIDGLG--TFLVRKTSPSGPVRVTDATAVTVL
                                :   : :  :  .    .   .     : .* * * ***.. * : : 

2069|gene|hla       YGDEDASRSDAGAGRDRRTASGSSTGSGPSSDRSIGTDTASTDTAGTDTSGTDARPPGGT
19030|gene|hbo      -----------------------------------AKQGTVSRVVTSVSGG--------G
2753|gene|hwa       RRGQ------------SSTDDRVFSTSTGTQRGRTGNETTNDNQDDTSTTPVSTSDSIDN
1|gene|hut          ------------------------------------GQPIDDPEPSEDDTT--------E
4184|gene|nph       ESPD-------------------------------ASDGITDSAPEQTETA--------E
1452|gene|hhi       PGLD-------------------------------GGSDAGQSSSGEATTA--------N
10807|gene|hma      PGLD-------------------------------GGSGAGQSSSDEATTT--------N
                                                         .                      

2069|gene|hla       EPPAEHTAGATYEDIGGLDEELELVRETIELPLSEPGVFTRLGIDPPKGVLLHGPPGTGK
19030|gene|hbo      DGDSDKPTGVTYEDIGGLDEELDLVREMIELPLSEPEVFAHLGVDPPKGVLLHGPPGTGK
2753|gene|hwa       ESSVAKSPTVTYEDIGGLDDELELVREMIELPLSAPTVFTHLGVDPPKGVLLHGPPGTGK
1|gene|hut          SGDASEPGSVTYEDIGGLDDELDRVREMIELPLSDPDVFDRLGIEPPKGVLLYGPPGTGK
4184|gene|nph       RAAPEPTPDATYEDIGGLDEELEQVREMIELPLSEPELFRKLGIEPPSGVLLYGPPGTGK
1452|gene|hhi       TPTAETESGVSYEDIGGLDEELDRIREMIEMPLSEPEEFRRLGIDPPSGVLLHGPPGTGK
10807|gene|hma      TPTAETESGVSYEDIGGLDEELDRIREMIEMPLSEPEEFRRLGIDPPSGVLLHGPPGTGK
                             .:********:**: :** **:*** *  * .**::**.****:*******

2069|gene|hla       TLIARAVANEVDATFITVDGPEIMSKYKGESEERLRDVFERASEEAPAIIFFDEIDSIAG
19030|gene|hbo      TLIAKAVATEVDATFITISGPEIMSKFKGESEEKLREKFEEARTNAPAIIFFDEIDSIAT
2753|gene|hwa       TLIAKAVANEVDATFINISGPEIMSKYKGESEEQLREKFEMAREEAPSIVFFDEIDSIAP
1|gene|hut          TLIARAVANEVDAYFEAISGPEIVSKYKGESEEQLREAFERAEDEAPSILFVDEIDSIAG
4184|gene|nph       TLIAKAVANEVDAHFEVIDGPEIVSKYKGESEERLRETFERAVDNQPAVVFIDEIDSIAG
1452|gene|hhi       TLIARAVANEVDAYFDTISGPEIVSKYKGESEERLREAFETAEANAPAILFVDEIDSIAG
10807|gene|hma      TLIARAVANEVDAYFDTISGPEIVSKYKGESEERLREAFEKAEANAPAILFVDEIDSIAG
                    ****.***.**** *  :.****:**:******.**: ** *  : *:::*.******* 

2069|gene|hla       KRDDGGDVENRVVGQLLSLMDGLDARGDVIVIGATNRVDTLDPALRRGGRFDREIEIGVP
19030|gene|hbo      KRDDGGDVENRVVGQLLSLMDGLDARGDVIVIGATNRVDSLDPALRRGGRFDREIEIGVP
2753|gene|hwa       ARDDGGDVENRIVGQLLSLMDGLDARGDVVVVGATNRIDTLDPALRRGGRFDREIEIGVP
1|gene|hut          ARDDDSDMENRVVAQLLTLLDGLESRGQVVVIGATNRVDAVDPALRRGGRFDREIEIGVP
4184|gene|nph       TRDEDADMENRVVAQLLTLMDGLENHGRLIVIGATNRVDAIDPALRRGGRFDREIEIGAP
1452|gene|hhi       SRDEDADMENRVVAQLLTLMDGLEDRGRVVVIGATNRVDAIDPALRRGGRFDREIEVGVP
10807|gene|hma      SRDEDADMENRVVAQLLTLMDGLEDRGRVVVIGATNRVDAIDPALRRGGRFDREIEIGVP
                     **:..*:***:*.***:*:***: .* ::*:*****:*::***************:*.*

2069|gene|hla       GEAGRRQILDVHTRRMPLADDVDLDRIAARTHGFVGADIEGLTQEAAMTALRRARESDAA
19030|gene|hbo      NEVGRREILEVHTRRMPLADDVDMDRLAARTHGFVGADLESLAKEAAMTALRRARRGGGE
2753|gene|hwa       DEKGRREILAVHTRQMPLADNIDLDRLAAQTHGFVGADLESLSTEAAMAALRRGRRDDDA
1|gene|hut          DREGRQEVLEVHTRGVPLDEDVDLERLAGRMHGFVGADVASVVTEAAMEALQRERDEP--
4184|gene|nph       DEGGRREILDVHTRGMPLSEDVDIDYLAARTHGFVGADIHSLATEAAMEALRSRDERG--
1452|gene|hhi       GEHGRREIMDVHTRDMPLHDDVDLDRIAAQTHGFVGADLASLTTEAAMAALRTDRDDG--
10807|gene|hma      GEHGRREIMDVHTRDMPLHDDVDLDRIAAQTHGFVGADLASLTTEAAMAALRTDRDDG--
                    .  **.::: **** :** :::*:: :*.. *******: .:  **** **.        

2069|gene|hla       A--LDDVTVGKADFEAAHAAVEPSAMREYVAEQPTTDFTDVGGLPEAKEKLERAVTWPLT
19030|gene|hbo      SVSFTELEVSRENFETAMASVEPSAMREYVAEAPTTTFDDVGGLEEAKRTLERSVTWPLT
2753|gene|hwa       AETLTSLSVTREDMMDAMAAVDPSAIREYVAESPTTTFDDVGGLDAAKQTLERAVIWPLT
1|gene|hut          -----S--VTRADFEQALAGVEPSAMRAYVAESPAGDFADVGGLDDVKETLREAVEWPLR
4184|gene|nph       -----ELRVTAGDFEAALTATDPSAMREYVAETPEAAFEDVGGLDAAKQRLTEAVEWPLS
1452|gene|hhi       -----D--VHQDDFETALATVDPSAMREYVAESPTATFDDVGGLAEVKQTLTETIEWPLS
10807|gene|hma      -----D--VHQDDFETALATVDPSAMREYVAESPTATFDDVGGLAEVKQTLTETIEWPLS
                         .  *   ::  * : .:***:* **** *   * *****  .*  *  :: *** 

2069|gene|hla       YGPLFEAADADPPTGILLHGPPGTGKTLLARGIAGESGVNFIQVAGPELLDRYVGESEKA
19030|gene|hbo      YAPLFEAANTSPPSGVLLHGPPGTGKTLLARAIAGESEVNFIHVAGPELLDRYVGESEKS
2753|gene|hwa       YGPLFDSVNTDPPTGALLYGPPGTGKTLLARAIAGEAEINFVEVAGPELLDRYVGESEKA
1|gene|hut          YGPLFEATDTDPPTGVLLYGPPGTGKTLLARSLAGETDVNFIRVAGPELLDRYVGESEKA
4184|gene|nph       YGPLFEETNTDPPTGILLYGPPGTGKTLLARALAGESDVNFVSVAGPELLDKYVGESEKA
1452|gene|hhi       YGELFTATNTDPPSGILLYGPPGTGKTLLARAVAGESDVNFIHVAGPEIMDRYVGESEEA
10807|gene|hma      YGELFTATNTDPPSGILLYGPPGTGKTLLARAVAGESDVNFIHVAGPEIMDRYVGESEEA
                    *. **  .::.**:* **:************.:***: :**: *****::*.******::

2069|gene|hla       VRDLFDRARQAAPVIIFFDEIDAIAADRDAAGGDSSGVGERVVSQLLTELDRASDNPNLV
19030|gene|hbo      VREVFERARQAAPAIVFFDEIDAIATNRD-AMGSDSGVGERVVSQLLTELDRLVDNPNVV
2753|gene|hwa       VREVFERARQAAPAIIFFDEIDAVAANRA-GGGTDSGVGDRVVSQLLTELDRITDHPNLV
1|gene|hut          VREVFERARQTAPSIVFLDEIDAVATQR----GESHEVTERVVSQLLTELDAAGEDPNLV
4184|gene|nph       VREVFDRARQAAPAIVFFDEIDALAGVR----GDASEATERVVSQLLAELDGLADNPNMV
1452|gene|hhi       VRELFERARQTAPSIIFLDEIDAIASHR----GQGNEVTERVVSQLLAELDGITENPNLV
10807|gene|hma      VRELFERARQTAPSIIFLDEIDAIASHR----GQGNEVTERVVSQLLAELDGITENPNLV
                    **::*:****:** *:*:*****:*  *    *    . :*******:***   : **:*

2069|gene|hla       VLAATNRRNALDPALLRPGRLETHIEVPEPDREARRKILDVHTRTKPLVEGVDLEHLADE
19030|gene|hbo      VLAATNRKETLDPALLRPGRLESHVLVPQPDVDARRAILEVHTKEKPLGDNVDLDELAAH
2753|gene|hwa       VLAATNRRDTIDSALLRPGRLESHIAVPRPDAAARRAILEIHLAGKPLADNIDRDELVGK
1|gene|hut          VLAATNRRDALDDALVRPGRLETHVEVPAPSRDARRAILDVHTATKPLDADVDLTEVATD
4184|gene|nph       VLAATNRKAALDPALLRPGRLETHVEVPDPGETARKEILDVHTRGKPLGEDVDLDEVAAE
1452|gene|hhi       VLAATNRRDMIDDALLRPGRLEQHVEVPNPDRDAREEILAVHTAGKPLAADTDIEDLAEK
10807|gene|hma      VLAATNRRDMIDDALLRPGRLEQHVEVPNPDRDAREEILAVHTAGKPLAADTDIEDLAEK
                    *******.  :* **:****** *: ** *.  **  ** :*   ***  . *   :.  

2069|gene|hla       TEGYSGAEIASLCREAALIAIERVADEHG-EAANDHADEVGITADDFAAALETVRPATP-
19030|gene|hbo      MDGLSGADIQAVCRDATMRAIEAIADAYEGAAANEHADEILVTQEHFEAALDAVAGEDE-
2753|gene|hwa       TAGYVGADIEAMVRDASVRAIESVTTEYDGATANEHADEIVLTRSHFETALDSIEPTENR
1|gene|hut          TAGFSGADLDALVRAASMRAIRRVAAGTDPSVANERTDEVTIRKQDFAAARERIEPSLG-
4184|gene|nph       TAGRSGAELEAVVRDASMRAIRELATELGPEAAADRADEVTIERRHFEAALDAIETA---
1452|gene|hhi       TDGFSGAELEAVVREASMLAIREVASAYGPEEATENAEEVEITPAHFSEALERERTR---
10807|gene|hma      TDGFSGAELEAVVREASMLAIREVASAYGPEEATENAEEVEITPAHFSEALERERTR---
                      *  **:: :: * *:: **  ::       * :.::*: :    *  * :        

2069|gene|hla       --------------
19030|gene|hbo      --------------
2753|gene|hwa       GEDSTMHDNGDDIY
1|gene|hut          --------------
4184|gene|nph       --------------
1452|gene|hhi       --------------
10807|gene|hma      --------------