HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0107COG0438KOG2941 KOG0853 KOG1111 KOG1387arCOG01407Glycosyltransferaseputative sugar transferase

HOG Organism Gene ID Name Annotation
cHOG0107 nrc1 VNG0600 str putative sugar transferase
cHOG0107 hmu HMUK1997 Hmuk_1997 glycosyl transferase group 1
cHOG0107 hma RRNAC1350 gtr-4 putative sugar transferase
cHOG0107 hwa HQ2500A hexosyltransferase 1
cHOG0107 hla HLAC1228 Hlac_1228 glycosyl transferase group 1
cHOG0107 hbo HBOR29830b Hbor_29830 glycosyltransferase
cHOG0107 hut HUTA2810 Huta_2810 glycosyl transferase group 1
cHOG0107 hut HUTA0778 Huta_0778 glycosyl transferase group 1
cHOG0107 hvo HVO_1168 HVO_1168 glycosyl transferase group 1 family protein
cHOG0107 nph NP3216A hexosyltransferase 1
cHOG0107 hhi 2117 HAH_2117 putative glycosyltransferase
cHOG0107 hhi 1939 HAH_1939 group 1 glycosyl transferase
MUSCLE (3.6) multiple sequence alignment


2117|gene|hhi       ----------------------------------------------MSKTPKLTYLISGL
29830|gene|hbo      ------------------------------------------------MHISHPASEKHL
1228|gene|hla       -----------------------------------------------MKVSHYFEFEDHV
778|gene|hut        -----------------------------------------------MLISHYFEWEGVI
2500|gene|hwa       ---------------------------------------------MTLRVLNYLELESRL
600|chp|nrc1        ----------------------------------------------MMRALNYLEAAEAL
3216|gene|nph       -----------------------------------------------MRVLNYLELEARL
11350|gene|hma      MPSERASSFDIMLWVLSGCSELLYGTQALPLTGKVDRIFGPAREPRDVRVLNYLELADRL
1939|gene|hhi       -----------------------------------------------MRVLNYLELADRL
2810|gene|hut       -----------------------------------------------MRVLNYLELERYL
                                                                               :

2117|gene|hhi       EIGGAEIGMVRLLDGIPEDELD-----------------VTVVALDGGKRTVVPDIPDHV
29830|gene|hbo      -EGGIKTSIQNQREAFEKQGIS-----------------YTPRFSRDA------------
1228|gene|hla       -TGGIHESVVHQRKMLDREGIE-----------------YTTEATLDA------------
778|gene|hut        -TGGHAQSVQNQRKMLDARDVE-----------------YTTEPVLDA------------
2500|gene|hwa       NRSGIGTAVDHQRAALNITDVADVEIYTSLRNALSPRNWIKDTLWSAA-------VDLDQ
600|chp|nrc1        -RGGMVTATNQQRAALETTDVE-----------------VVETPWRAG------------
3216|gene|nph       QRSGIGTATRQQRRALSPTDVE-----------------VVKTPWNGA------------
11350|gene|hma      DRSGIGTAVDHQRAALSETDIE-----------------VETTPWQEG------------
1939|gene|hhi       DRSGIGTAVDHQRAALSETDIE-----------------VETTPWQEG------------
2810|gene|hut       GPSGIRTAASQQRAALETTDVD-----------------VVTSPWDGR------------
                      .*   .  .    :    :                                       

2117|gene|hhi       DIVDLQIENKLLIHK--------------------------LLPLIPILRETDILLGSIY
29830|gene|hbo      ----------------------------------------------EILHLNVPTPRTYV
1228|gene|hla       ----------------------------------------------DVLHCNLMGPRSVW
778|gene|hut        ----------------------------------------------DILHLNNMGPRSIY
2500|gene|hwa       DSGDSYRSNKEYSDTDSNSSPPHTHVSAVDGSDSTADSERGCESDIDIVHCNLVGPGSFA
600|chp|nrc1        DPVRSIGSLAA-GGS--------------------------CFTAFDVAHCNLVGPGSVA
3216|gene|nph       NPAEAAFRRAV-GGR--------------------------FFERVDLAHCNLVGPGSAA
11350|gene|hma      HPAWALGGNIAFNDP--------------------------MFREFDIAHCNMIGPGSVA
1939|gene|hhi       HPAWALGGNIAFNDP--------------------------VFREFDIAHCNMIGPGSVA
2810|gene|hut       NPATAAATNLG-NGS--------------------------LWADFDVVHANLIGPGTIA
                                                                   : . .     :  

2117|gene|hhi       HAETVARLFDLVIPVNTLLT-------WAHNTEFKTPIRRWVDKLTIGRCDAILADSEAV
29830|gene|hbo      QLRRAKRA-GIPVVMHTHEIGENFQESFRLSTTFSPIVRRYV-DFFYKRADHLIAPSEYA
1228|gene|hla       YAKRASDR-GIPVVAHTHVTAEDFGDSFRFTNALAKPLKPYL-SRAYRLADALVCPSEYN
778|gene|hut        YAKRAQRA-DVPVVVHAHQTAEDFRESFAFSNALARPMRPYL-EYAYSLADHLICPSEHN
2500|gene|hwa       AAQYALRS-EIPLILHAHITREDFAESFRGSTTIAPVVERYL-KWFYSHADLLLCPSEYT
600|chp|nrc1        VARHARRT-DTPLVLHAHLTREDFAQSFRGSSTIAPALEPYL-RWFYSQADLVLCPSEYT
3216|gene|nph       VARRAIRT-GTPLVLHAHITREDFAGSFRGSRAVGPVLERYL-RWFYSQADLVVCPSEHT
11350|gene|hma      VARYAAQA-DIPLVLHAHVTREDFRDSFRGSNLIAPVLGRYL-RWFYSQADLVLCPSEYT
1939|gene|hhi       VAQHAAQA-DIPLVLHAHVTREDFRDSFRGSNLVAPALGRYL-RWFYSQADLVLCPSKYT
2810|gene|hut       VAKHARRH-DIPLILHAHVTREDFQESFRGSNLVSKPLGWYL-RWFYSQADLVLCPSEYT
                        .       :  ::          :  .  .   :  ::       .* ::. *:  

2117|gene|hhi       ATMLVERQEVDPEKIWTVPIAGLSMSEYDRPPVPLRSLDYSVVGGEPLDHVGE---GMIV
29830|gene|hbo      KRVLKQRGLNTPISVVTNGIDPDRLAGV--YTGEYSP-------KSTIERNGEQESRLTV
1228|gene|hla       RGVIEEY-TDTPTTVISNGVDREKLAGFESLEDEYRE-------RYDLS-------PPTV
778|gene|hut        QDVIETY-TDTPTTVLSNGFDPDRLTGFESLREEYLN-------RYDLD-------PPVV
2500|gene|hwa       RSVLQAYPVETPIRVITNGVDINALSGFESYREEYRQ-------KYHLS-------GPVI
600|chp|nrc1        KDVLRAYPVDAPIRQLSNGVDLESMQGYESFRADTRA-------RFDLD-------GTVV
3216|gene|nph       KRVLSSYPVDAPVRVVTNGVDIESLAGHEALRDRYRS-------RFDLD-------GTVV
11350|gene|hma      KGILESYPVDAPIRPMTNGVDIDALAGHEDMREDYRR-------RYDLD-------GMVV
1939|gene|hhi       KNILESYPVDAPIRPMTNGVDIDALAGYEDLRQDYRQ-------RYDLD-------GMVV
2810|gene|hut       RRVLESYPVSAPIRPMTNGVDLASLEGYGKFRASARE-------KHDLD-------GVVV
                      ::       *    :  .    :                      :.          :

2117|gene|hhi       VGTVGTLSAAKNHDAILEVASRLSDRK-VHFA---IAGDGP----QREELVDEVVERELT
29830|gene|hbo      AN-ASILFERKGLSDFTAVARQLQDVNFAWFG---PRFNRF----LTGSSVDKTIQQAPS
1228|gene|hla       FL-VGHVIKRKGLETFVDLARELPDIDFAWFG---PLDLS-----LKGRETTRLIEESPE
778|gene|hut        FT-VGHVIPRKGLEAFVETARAMPDLDFAWFGYLNPTGGGPVDRLLRSKETTRLVENAPE
2500|gene|hwa       FG-VGNVFERKGLTTFCQVAEQ-TSYDFAWFG---PYDTGP----QASRTVQRWTNNPPS
600|chp|nrc1        YA-VGEVFERKGLTMFCELAKA-TDHEFAWFG---PYDEGP----QAGAATRKWVADPPA
3216|gene|nph       FA-VGNVFERKGLTAFCRLAER-TDYEFVWFG---PYDTGP----HASPTVRRWVKDPPE
11350|gene|hma      FA-VGNVFERKGLTTFCELAQE-TEHDFAWFG---PYDAGP----QASKTVSRWVNNPPE
1939|gene|hhi       FA-VGNVFERKGLTTFCELAQE-TKHDFAWFG---PYDAGP----QASRTVSRWVNDPPE
2810|gene|hut       FA-VGQVFERKGLSTFCRVAQQ-TPYDFAWFG---PYSTSP----LASKTVKRWTEDPPE
                       .. :   *.   :   *      . ..*.                  .         

2117|gene|hhi       NVSFIGRVDSVPEFLSAVDIYFQPSHYEGLCITVLEAMAAGKPIVASTAGEIPRNVRDGK
29830|gene|hbo      NCVFPGFADDVRDVYAASDVFFFPTKSETEGISIIEAAYCGIPIVTRDIPVYEPLLEHGT
1228|gene|hla       NCTFTGFVDDIRGAFAAGDVFLFPTHEENEGIALLEAMTAGKAVVVRDIETF-SWLDHDE
778|gene|hut        NCTFTGYVEDIRGGFAAGDIFFFPTKNENEGMALLEAMACGRPPVVRDIPTF-EWLEDGE
2500|gene|hwa       NVTFTGWVDDIRGAYAAGDIYFFPTKNENQGIAVLEAMACGKAVVLRDIPVFEEFYTHNE
600|chp|nrc1        NVTFTGYMEDKRAAFGAGDIYLFPAKVENQGIAVLEAMACGKPVVLRDIPVFREFFTDGE
3216|gene|nph       NVTFTGWVDDIRGAYAAGDIYLFPTKAENQGIAVLEAMACGNAVILRDIPVFEEFYTHGE
11350|gene|hma      NVTFTGWVEDIRGAFGAGDVYLFPTKAENQGIAVLEAMACGKAVVLSDIPVFREYYEDGH
1939|gene|hhi       NVTFTGWIEDIRGAFGAGDVYLFPTKAENQGIAVLEAMACGKAVVLSDIPVFREYYEDGH
2810|gene|hut       NVTFTGWVDDIREAYGAGDIYLFPTKTENQGIAVLEAMAAEKAVVIRDIPVFEEFFTDGE
                    *  * *  :.     .* *::: *:: *   ::::**  .  . :             . 

2117|gene|hhi       EGFVAEP----ENIEAFVEAIETLLDDPELRSRFSESSRQRVVERYSQEILVERFWDVIE
29830|gene|hbo      HCLKG------SSVEEFKNHIKLLQNDPELRKRLGENAREL-AEQFTIGAVGKELESVYQ
1228|gene|hla       DCLKVDPAAADDETEAFADAIRRLT-DPTLRERLGSNAAAR-SESFSLDAIAERYRSLYE
778|gene|hut        DSLKA--------SEDFTDPLDRLR-DPELRERLGQRAAER-SEAFTLDAIGDDLVDLYR
2500|gene|hwa       DCLKC------ETQAEFRDAINCLVNDPTLRSRLGENAKAT-AHEHDLEGVGDQLAETYK
600|chp|nrc1        DCLMC------STFEAFRDAIDRLADDPELRTRLGENARET-AESHSLDRIGEELASIYE
3216|gene|nph       DCLKC------DTRSEFEAAIDRLASDPDLRARLGDTAATT-AREHGLDRVAEELRDAYS
11350|gene|hma      DCLIC------ADEAEFREALERLAENPDLRERLGENARET-AREHSLDRVSRRLVETYE
1939|gene|hhi       DCLIC------ADEAEFREALERLAENPDLREQLGENAKET-AREHSLDRVSRRLVETYE
2810|gene|hut       DCLKA------ETDAEFREAVERLAEDPELRERLGENARET-AEEHSLDRVGEELVSVYE
                      :             *   :  *  :* ** .:.. :       .    :     .   

2117|gene|hhi       KTYFDGSKS---------
29830|gene|hbo      TTV---------------
1228|gene|hla       SV----------------
778|gene|hut        QVLSN-------------
2500|gene|hwa       TVITATEAGHEITSTDIT
600|chp|nrc1        CLRDGDVASAVAATEG--
3216|gene|nph       DAQRLAGAEHTTD-----
11350|gene|hma      ELA---------------
1939|gene|hhi       ELA---------------
2810|gene|hut       ALLDGRDPIED-------