HOG Organism Gene ID Name Annotation
aHOG1069 hhi 3098 HAH_3098 dolichol kinase-like protein
aHOG1069 hbo HBOR01660 Hbor_01660 dolichol kinase
aHOG1069 hla HLAC0292 Hlac_292 dolichol kinase-like protein
aHOG1069 hmu HMUK0797 Hmuk_0797 conserved hypothetical protein
aHOG1069 hut HUTA1487 Huta_1487 conserved hypothetical protein
aHOG1069 hwa HQ3710 homolog to dolichol kinase
aHOG1069 nph NP2992 homolog to dolichol kinase
aHOG1069 hma Hma_12702 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


292|gene|hla       ------------------------------------------------------------
1660|gene|hbo      ------------------------------------------------------------
3710|gene|hwa      MIPNPDERIGSNTDADTDGRAESESGTESSAEADQVESVFTVLNGVSVSIEDNKYVTLVL
2992|gene|nph      ------------------------------------------------------------
1487|chp|hut       ------------------------------------------------------------
3098|gene|hhi      ------------------------------------------------------------
12702|hp|hma       ------------------------------------------------------------
                                                                               

292|gene|hla       --MPLPAAEWRAEVEFERRLVHSGGTLYPVPYLLG-------WFTWTETRYFLVAALAVV
1660|gene|hbo      ----MSPRISVSKSEVKRRLVHASGAALPFGYVLD-------IVSWAQLRYLMVFLTVVV
3710|gene|hwa      NHSDNSNSRSVSGNEIKRRLVHASGTVLPLLYVIN-------ILSWSVFEIIMIIGAATA
2992|gene|nph      -----------MPFEIRRRLVHASGAAVPGVYLLDNHAIGAGLITWQVVQLLAVVGLVAT
1487|chp|hut       ---MFASFLDRIDDEVTRRLVHASTSVLPLAYVFV------AELTWRHVQALLVLAMVGA
3098|gene|hhi      -----------MADEVSRRLVHVTGAAVPLAHLLR-----PDLITWRVVQGFLAVALVVV
12702|hp|hma       -----------MADEVSRRLVHVTGAAVPLAHLLR-----PDLITWRVVQGFLTVALVVV
                                 *. *****   :  *  :::         .:*     :     . .

292|gene|hla       LTLEFLRLVVGFDHALYQKLIREYETDSIAGYALYQVSMTGVVLLLNP------------
1660|gene|hbo      AVLEFLRLRVGLDWAIYDELTRSYEQTNLAGYALYIFSMTAVVLVFEP------------
3710|gene|hwa      ALLETVRLFIGLEWRIYDELTRSYEQTNIAGYALYAFSSTTVIIVFTP------------
2992|gene|nph      AVLEVARLYGGLEHAIYDQLTREYEQETVAGYALYVLGATIVVFVFEP------------
1487|chp|hut       LGLEIVRLYVGLDWWIFDRLTREYEQENLAAYFLGGVGLTVVAFAFPPAGADPLIGSPFD
3098|gene|hhi      LILEAVRLTTGLDWVVYDRLTREYEQDNPAGYALYIVGIAIVAFAVELPSMT--------
12702|hp|hma       CVLEAVRLTTGLDWVVYDRLTREYEQDNPAGYALYIVGIAIVAFAVELPGMT--------
                     **  **  *::. ::: * *.**  . *.* *  .. : * : .              

292|gene|hla       --TLAIPAMWMLSLGDPVSGALGDN-DATEAKRPAAWIAMFLVSLSLALLFTVPAFGTGV
1660|gene|hbo      --YVAVPGMLMLALGDPVSGLLGRTREAGEPKRLGTLAAMFIVCLAVSVPFLLPVAGT-I
3710|gene|hwa      --VIAVPAMMMLTLGDPISGLLGTTRAAGESKRPRTLIVMFTVCFVIGLVFLFPIAGT-T
2992|gene|nph      --TVAVPALFMLTLADPVSGMLSGN-EFRRVARPRVFAGMFLVSFALAYPFVSAAA----
1487|chp|hut       PSPVAVPAMLMLTIGDPFSGLLGAG-ELQAVKQTWVLLAMFGLTTLIASAFVPPLP----
3098|gene|hhi      -ETVAVPAMLMLAIGDPISGLLGSA-DASNVKQAWVLLVMFGVCTLLAAPFVPPAA----
12702|hp|hma       -ETIAVPAMLMLAVGDPISGLLGSS-DASNIKQAWVLLVMFGVCTLLAAPFVPPAA----
                      :*:*.: **::.**.** *.         .  .   ** :   :.  *  .      

292|gene|hla       GIAVALAGAVLAAIADGLPPIIRGVAVDDNLTIPPAAAGGMLLAV---TVL-GVGV-
1660|gene|hbo      GVIAAVAGSVGATIADGMKPVIRGSVIDDNASIPPAACLAIAAVL---AATGAAAVT
3710|gene|hwa      GVISAGVAAIGATVADGIKPVVGGYVIDDNFSIPLIAATGSSIILFVGGHQPIISLY
2992|gene|nph      ----AVAGAVGAAIADGVKPVVGGYVVDDNLTIPVVSAALMWAAR---T---ALGV-
1487|chp|hut       ----AILGGLAATVADGAKPVIRGYVVDDNLTIAPSAAVAMFVAI---EYLPALGV-
3098|gene|hhi      ----AVLGGIAATFADGVKPRIAGYVIDDNFSIPVLGALAMWVGV---QYLPGFGL-
12702|hp|hma       ----AILGGVAATFADGVKPRIAGYVIDDNFSIPVLGALAMWVGV---QYLPGIGL-
                       *  ..: *:.***  * : * .:*** :*.  ..                .: