HOG Organism Gene ID Name Annotation
aHOG1067 hhi 2371 HAH_2371 hypothetical protein
aHOG1067 hbo HBOR24600 Hbor_24600 hypothetical protein
aHOG1067 hla HLAC0190 Hlac_190 hypothetical protein
aHOG1067 hmu HMUK3052 Hmuk_3052 conserved hypothetical protein
aHOG1067 hut HUTA0011 Huta_0011 hypothetical protein
aHOG1067 hwa HQ1185 hypothetical protein
aHOG1067 nph NP5214 hypothetical protein
aHOG1067 hma Hma_11853 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


11|hp|hut         MGVRDNTRDRNARKSNRNPLSRLEGDDRGRVPFAIIGVLLLLTSVTFVGHTLTRSGVTTD
2371|hp|hhi       -------------------MVSVRDDTRGRIPFALLGVLLLVSSLTLAPTFVSEPAP-SE
11853|hp|hma      --------------------------MRG-------------------------------
5214|hp|nph       ------------------------MNDRGRVPFALIGVLLLVTSGTLAVSVSTHDAG-TD
190|hp|hla        ---MGKLSPGTNASCSGTRCRSFTVDERARVPFALIGVLLLVTSSTYAAGIADQGLIGED
24600|hp|hbo      --------------------MRLADDNRGRVPFALVGVLLLVGSSTFAASLASPDTGVVD
1185|hp|hwa       ------------------MGRSIGSDDRARVPFALVGVLLLVGSSMITFSLATPGAAPVD
                                             *.                               

11|hp|hut         VDASVAISQTESVAQSAIRTGAQRGVEAAAAQPLT-QASETDWGRVLQGKATGTVGPDAG
2371|hp|hhi       TAVERALNQATAETQVAVRDGVSTAGRQAAANPVV-TPADTPTGRVL------------N
11853|hp|hma      ------------------------------------------------------------
5214|hp|nph       TSTDRAVGGAAAAATTELRGAADAAATAAAAEPTT-TPANTTAGRAL------------D
190|hp|hla        RSVERAVERVDADSTAALRAAARQAAHDAAAEPVTRAPDGSAAGSED------------G
24600|hp|hbo      RSTDVAMERVDAETTAALRVAVREAACAAARDPVT-TPANSAVGRTL------------G
1185|hp|hwa       RTADAVADRVDAETTAALRGAIRRAAHAAAREPVT-IPTESAVGRAL------------G
                                                                              

11|hp|hut         GIATEPGTTDTFRNYLRAMIYRDVESSLERAGQQSGDVETTVSVPTIEAP-ADLRAAIDR
2371|hp|hhi       GSTA-------FRDSLRIRAYLRVADRLERVTGRSGDVTVTASLPTVSNA-SDLRAAKRR
11853|hp|hma      -----------------------------------------------------LRAAKRR
5214|hp|nph       SEQP-------FRDSLRLRVYLRALDRVDGTTFERDGTVVSASLPDVEPTREGYREAIQR
190|hp|hla        HGSTAVRNGSAFEDAFRIRLAIAGSEALAAVDAEVGDVTATASLPAVDGP-SELAAARDR
24600|hp|hbo      PNET-------FHNYLRLRIALAARDALSGVEHRRGMTTARATLPPLS---AGLDAAVRN
1185|hp|hwa       TTAT-------FRRALELRIYLQTREALMNIEHQRGRSAARVTLPQY----SDIEPLLTH
                                                                             .

11|hp|hut         VSL--AQPEDGVLEVTIENVTFIARSGGRVIEDRETTMTVSIATPIMQLHQRVERFENAL
2371|hp|hhi       VSVERAGPNETAMRATVENIVLTVRRNGAVVSTRRVSPTVVVPNQALMLHDQVSTYQTRL
11853|hp|hma      VSVERAGPNKTAMRATVEDVVLTVRRNGAVVSTRRVSPTVVVPTQALMLHDQVSTYQTRL
5214|hp|nph       VEVERAGKEDTALAVELTGLSLTVSRENQTVAETERSPSVVVANPALSLHDRTERFERRA
190|hp|hla        IRVE-PAANGTATRVTFEGVETTATRSGRTVVERTEDRTVVVAVPTLAAHERTERFEERL
24600|hp|hbo      VSVS-SENEGRALTVAVSNVSLVATHEDRVVATRTVTRRVTVAVPVLALHARTTDYQRRL
1185|hp|hwa       VSVV-GVDDGTELRTTVRGIQLTVMRDNRVVNTRVINRSMTVAVPVLALHDQTVKFQRRL
                  : :     :     . . .:   .   . .:        : :.   :  * ..  ::   

11|hp|hut         DAG-VTERGFTQRFNARIYALGWARGYAQNYQAPIAQVLANRHIEPAANDAVYRTQKDIF
2371|hp|hhi       NNG-LDKPGLSQRMTARLYPMAWARGYAQYGGAGVENVVANRHVSLATNGALLGVQRSTF
11853|hp|hma      NNG-LDKPGLSQRMTARLYPMAWARGYAQYGGAGIENVVANRHVSLAANGALLGVQRSTF
5214|hp|nph       NAP-VTRSGLSQRLTARLYPIAWSRGYAQYGGAPIATVLGTRHIELATNDALLAEQRTAF
190|hp|hla        NRGPVEGPGLGRQITASLYAMTWARGYGQYAGAPVENVLANRHVELSTNAGIVRTQRDVF
24600|hp|hbo      NESPVYAPGLARRTTAGLLAITQARALGQYAGAPIENVLGNRHVELSTNAGVLAAQRASF
1185|hp|hwa       DADALGGPGLARRTTIGLNAITQARGLGQYAGAPIENVLSNSHVTLSTNAGLVDSQRAVF
                  :   :   *: .. .  : .: .:*. .*   * :  *:.. *:  ::* .:   *.  *

11|hp|hut         GAADPELQDANRLGWTCMALKDGGAMFDEYMGSNDVSYGNSTYTGDELVFERSNGSDFAA
2371|hp|hhi       GRSDPAGRR---------ALTEATAM----TGIEDV---------------------VRG
11853|hp|hma      GRSDPAGRR---------ALKEATAV----TGIKDI---------------------IRG
5214|hp|nph       GAADPAGDR---------GVAAAGRR----VATTDL---------------------LAG
190|hp|hla        GTSDPNARG---------GVARATAR----TGVTDL---------------------LKP
24600|hp|hbo      GRVDPDAKR---------GVRAATLR----TGLTDL---------------------LSP
1185|hp|hwa       GRSDPDAAA---------GLRIATLN----TGMNDV---------------------LTP
                  *  **             .:  .        .  *:                     .  

11|hp|hut         SVPADGSSVANTLCSGAEMALGDQVTGELPSAPGIGDLRGDAPAMNTTDTIGVNETAYVP
2371|hp|hhi       SR---GSAVSSDVLDQADYKPVSETPPRPK--------STASPSPGDSMTIGVNETADTA
11853|hp|hma      SR---GTAVSSDVVGQAQYKPISETPPRPK--------STTGPSSTDSMTVGVNETADTA
5214|hp|nph       VG---GDEEWTDMVLEAADELGPDPPDKQPVG------TWREEPEADDVTVDVGASADTA
190|hp|hla        TGVDEGS--WTEAVLSAP-TPGVRDGPGERDGSGENDTPGDQPSEDAAFEFGEERTDERT
24600|hp|hbo      VA---GGSTTEKLVSAT-------PSPNPR--------PTPTTMPTGTLTVGVNETADDA
1185|hp|hwa       LT---PPRVSAVVTGAI---PGPNAPERLRVRETKSKYPDPVPSAERTITVGVNGTADEA
                                                                    ..   :   .

11|hp|hut         LAKMAAGD------GEHAIESAIDRIYTIDGQAKTQTTVTDSLDLSGNATCNNSNNADGT
2371|hp|hhi       FRSVTEPS------ALNE---TLEDAYTVEVALEVDE---HRLG----GGPPGKPASPG-
11853|hp|hma      FRSVTKPS------ALNE---TLEDAYTVEVALETDK---HRLG----GGPPGTPSSPG-
5214|hp|nph       FADLVGST------GTDELARVIERAHTVEARVVAET---DRTD----RRA-DTDGSPG-
190|hp|hla        SVPVGRAADEGATRVYDDLDAIIESAYRVEARVETSTTQVVDGG----RPTPPTPSPSEF
24600|hp|hbo      FLAFLRGTDDSSDTALDS---VIRTGYTPSVTVVSDVLDENEGH----RPAPEAPDSSD-
1185|hp|hwa       FLAVIRGGDTTA--SYKQ---ISQTGYTAWAQLTTDV---DIQW----RGRPKTPTPPG-
                     .                      :        .                    .   

11|hp|hut         YTITDWQPVNGTTITDAMPQDEYYDATATVQARVTKYKRCHPE-PENPIVATDSVTFEVA
2371|hp|hhi       ---SEWTLVADRTTTSVEAVGNASGGVATPDGWH----------RLETFSRTVERQYTRT
11853|hp|hma      ---TEWTLVADRTTTTTEAVGNASGGVATPDGWH----------ALETFSRTVERQYTRT
5214|hp|nph       ---SDWELVADRSHESVSV-ESAGGQPPAADDWA----------TRDGAAFDATVVERVT
190|hp|hla        TTTGDWERVDLTRTERSPIIS----GSGVPEGVPSGIVDPGERVSFGLETREATVKRVAV
24600|hp|hbo      ---VSWSLAAEDVDSDVSVVDR---GTAAPPSVGVGAR------AFKTTTRQVVVRHTVT
1185|hp|hwa       ---ANWTLAETDVSRKVTV------TPASPTWVSPRFSDGIGRQTINIAARSVTVDSTVQ
                      .*  .                                                   

11|hp|hut         TTF-------------------EEADANPNARIDEMNSVSIGKHKYARGSRIDGLPADFR
2371|hp|hhi       AVW--------QNGS-----VRRRTTVSSTAR-YRVTVAVVGRHH----GRSVAPNRSIR
11853|hp|hma      AVW--------QNGS-----VRRRTATSSTVR-YRVTVAVVGRHH----GRSPAPNRSIR
5214|hp|nph       RTW--------SDGN------ETTTTGGVIEREYHVRVAAQARTK-----PIAGVPFGPL
190|hp|hla        AEWERVTVERGPNGSVVDERVHRATTRDAVTDHYRVRVSVSGEHA-----PTDGAPDRAT
24600|hp|hbo      RTW------RAANHS------SRTTTAQWTDR-YRVRVAVVGSLR-----SLPGPDRAVE
1185|hp|hwa       WTW------HAPEKS------PRTTTDSWRQR-SHVQIHLTGRVV-----PLAVPTRGIS
                    :                     :          :     .                  

11|hp|hut         N-YDGGGEKLTASLLGGDTSADAYAAWVEAALPNRIDTEANVTTHLDDELTVETRVTLDH
2371|hp|hhi       TAHDASASPLNGSNL-ADVEPKAMDRLV-GHAGGRDETAERVVD--DSLGRTEATVTADR
11853|hp|hma      TAHDASPSPLNGSNL-ADVEPKAMDVLV-SHTGGRDGVAERVVD--DSLSRTEATVTADR
5214|hp|nph       ERFEAATERAVSQAV--------------ARGDGLDGAAATAAS--SDRLQATAAATAPR
190|hp|hla        ATFGAGDA-SDGPDL-RDTPPIARVDLDVDTENGVDRITEDAIS--GGEVTRSTTVVGSR
24600|hp|hbo      PLFERGGA-LSGPNL-ESVARLARDEL--AARGGANTVARQAVT--GSADYDPARAETDR
1185|hp|hwa       PSFEPGGA-IDGPNL-VETTNAAQRLL--RNNGGYDDIARQAAV--NGDVTATQTVRGQR
                    .  .     .  :                  .       .    ..       .   .

11|hp|hut         EQFLDANLAAAIVSDLDEMQRAAAAITAEYSRTDLLKRGTQSPVTGLIERTKTNLTTQYL
2371|hp|hhi       PPELHEWVYRDLMALREPIRNTTVTVERGRVGT-----FETNPPRELRERVA-QRRADLA
11853|hp|hma      PPELRNWVYRDLMTLRASVRNTTVTVERGRVGT-----FETNPPQELRERVG-QRRATLA
5214|hp|nph       SVS-RSDVEMAVEATHETARNRSVTAAAPAVGT-----GRVNPPDRLRTALEADREQFIV
190|hp|hla        SEADRNAVAADVAALASDVRDIETEASMEDAAV-----GEAEPYADLADAIR-DRRAELV
24600|hp|hbo      PSALRAWVYADVAALRERVRNVSVDVAAQETAT-----GHANTAATLAAALR-DRRAELV
1185|hp|hwa       PESLSTWIYEDVSSLREQVRTISVTVSGDDIAT-----GQANAAEQLTDILD-RRRYSLI
                         :   : :     .   .        .        ..   *             

11|hp|hut         DRTEPYESVGQKVIYEARYAYLQALIAELETLEDGHESAVGGIDEQFSAVGLSLEKALTF
2371|hp|hhi       AVPDTYDSTAQKARAAARLTYLNAVLTELDRQASVRDSNRKRVDAQLTE-R--TEGSLRA
11853|hp|hma      AVPDTYDSAAQKARVAARLTYLNAVSAELDKQASARNGHRKRVDAQLTE-R--TEGSLRA
5214|hp|nph       DADPK---PAVRTKRAAQLAYLDGVDASLSERETAHDGAADGIDDTVGE-H--IDPS--R
190|hp|hla        DAPVTYDGAADRAGTAARTAYLDAVIDELESAASDRERATDGFLDRVNS-A--FDGP--D
24600|hp|hbo      DAPATYDGVADRVRVAARAAYLDTVLARLDERAAEAAGRNDRLQDALASRG--VNAT--A
1185|hp|hwa       DPPRRYDGVADRVRVAMRGAYIDAVIAQLEEQSEQTTQQNNGITERLDVPG--ISASHIN
                           . ..    . :*:: :   *.            .   .       . .   

11|hp|hut         LQEGVSA-EAPDPVPLNSS-----NLTGRVSYEVTGSPTYLVAENLTKRDVPAIAANTTF
2371|hp|hhi       LRKGLTARETRVPRSRPVPV----GPAGPVRTRVDTQTPYLTLAELNESRYRAL-DGSEH
11853|hp|hma      LRKGLTARETRVPRSRPVPV----GPAGPVRTRVDTQTPYLTLAELDERRYRAL-DGREH
5214|hp|nph       LDGALAAHRQAAKPPTESYA----DPAGTVSFEVETAPSYLTTSAVERDRIDARGGGSVY
190|hp|hla        VGDALASREAA--RDSGTYAIGEDGPGGAVTFEPNGSPGYLPRTTVDGEAVDGV-DGTTT
24600|hp|hbo      TRDRLSSRTTADTRELSN---------SSAAFVPDGDPAYLSLSGVDGRAIDGVADDATY
1185|hp|hwa       KLAGLTPMTTPPPRTLGTAN----GISAPLTIIPDGDPAYLGVSPVNATLVDGVSDETSY
                      ::.                    .         . **    :      .       

11|hp|hut         TPFAMRNEELFDSPVDDITGDIVKAV-LSVFDLGGPDGTVPIKTAGDVLLAGNLADAAEE
2371|hp|hhi       -PLVARNANVFTVPYGDAADAVVGGA-F------EGGDRVRLATAANALAAANETLEDES
11853|hp|hma      -PLVARNVNVFTVPYGDAADAVVGGA-F------ESGDRVRLATAANTLAAANETLEAGS
5214|hp|nph       -PLATRNVNLFPSLHDPVADSLFDRIPF------FGTERTSLSRAASTLAAADPD-----
190|hp|hla        RPLAVRNVNYVTVPYGEVSSGVVDRI-L------GTEDTVRVGTAGRSLLLANDALAADD
24600|hp|hbo      TPLAARNTNLFTLPYGDLADAVVGDI-F------GPGGEVSLRTAGRALVAADRTLAVQS
1185|hp|hwa       IPLAARNQNVFAIPYADTADTIVSQV-F------GSGGRVSLQTAGQALIAADTRLAVAP
                   *:. ** : .       :. :.    :           . :  *.  *  .:       

11|hp|hut         NPITNSSFEGALDTFEVEVAESVSTVGESVADDTVRQLYPTEPAACVVSEGRSAPGRGVT
2371|hp|hhi       SATLASERDALQREVEAANEELTTTLWLAVSQHT--------------------------
11853|hp|hma      NATLASERDALQREVAAANTEMTTTLWLAVSQHT--------------------------
5214|hp|nph       ----EHGYDRLASAVAASSRYVRGDVAAALIDA---------------------------
190|hp|hla        DPDLRADRDALARQIDGSLDEVDGALGSTLRVRT--------------------------
24600|hp|hbo      DSTLRRRSNELRKEVKHSLAPVRETAASTVERET--------------------------
1185|hp|hwa       DTTLRTRRNTLAAAINDSMEDVEQQADHTLKSET--------------------------
                          :     .             ::                              

11|hp|hut         CSDRYSESLIETITAAHTEIERRTDVALDRYNTTGRQAIAIGTGNATEPILEGVSDAIDA
2371|hp|hhi       -------------EAEQGESKAIVTEALSPWDTPAARALALTNGSAQERVAHVA------
11853|hp|hma      -------------EAEQDESKAIVTEAMSPWETSAARALALTNGSAQERVARVA------
5214|hp|nph       -------------GVAPDEAMAALEAD----GGTAEEALRLANGTAVDQAVEAV------
190|hp|hla        -------------SLSRDERRRALDEAAASYGSPGERAVAVGDGSYPDRVAAEA------
24600|hp|hbo      -------------DLTHAESEDAVAAGLAHWDGVGQRAVAASNDSLATAIATEA------
1185|hp|hwa       -------------DLSNAARTAAIDDSIAMWDD-GSVALAAANGSLAKAISTKALSQGSA
                                                    .  *:    ..        .      

11|hp|hut         D-------AYRHATVFESDDDD----QWRILVESALRPAIENASAIEVDIEHNKNVEIIE
2371|hp|hhi       ----------GARLNLTRVERD----RLRLTLFSVDTPAT-RPTLESTNGTASAVRSVAK
11853|hp|hma      ----------GARLNLTRVERD----RLRLQLLSVDTPAT-RPTLESTNGTASAVRSVAK
5214|hp|nph       ----------EGNVDDSRLETE-----ATAALSAALKRDDARPPAEPVDELHERTREQYA
190|hp|hla        ----------ASVGSLSRAAEEALAANLRVATRTAAGRDAVRVPTRFVDETTSGARVLLR
24600|hp|hbo      --------DLDGEMAQDRVATA-----LRVELRETTTASRVRVSEAAVNGTATRTRTLVR
1185|hp|hwa       AYTYGHENEYEHEYEYDRVETA-----LRVDLREVATSKSVQVPKPAVDDTMSSLKQGAQ
                                                    .      . .   .:           

11|hp|hut         QAVKTKIGNVASEAIEKRLEDVAKEAKERVRDKMDQWAGSWSKKIKRPARIAGGVPLLPV
2371|hp|hhi       DELSKALAN----AGEQKVQQFAKKRLGTD---------------KLPA----GLPLAPP
11853|hp|hma      DELSSALAN----AGEQKVQQLAKKRLGTD---------------RLPA----GLPLAPP
5214|hp|nph       DELEGTLADGLEAGEERARERLLGESMG-----------------AMPA----GFPLAPI
190|hp|hla        DRMEKAVENQAARAGKAATGKVSEKAVKELGEKWSMKPAR-----TVGA----GLPVAPV
24600|hp|hbo      ELGREAASR----GADRLTSHALNGTLG-----------------AVPA----GLPLSPT
1185|hp|hwa       SVASGAAAN----ATERAVTRATKGTVT-----------------TIPA----GLPVLPT
                  .            . .                                *    *.*: * 

11|hp|hut         PTHWYATMNAWDVTVAGEYARFEVTANVGSPTQT-TATTYVRENQTVTADIAGESRS--L
2371|hp|hhi       VTPWYATANIWWVTVKGEYARFAVSASHGPPREPGARTTYARDGHNVTLDVDDDGSTERL
11853|hp|hma      VTPWYATANIWWVTVEGEYARFAVSASHGPPSEPGAQTTYARDGHNVTLDVDGDGTGERL
5214|hp|nph       PGYWYATVNVWYVDIAGTYERFAVRSNRGGPQ---AATTYLRDGRTATVAHDGKTAV--L
190|hp|hla        PGYWVTTVNAWRVQIRGEYPRFALRANVGTPD---KRFTYVRSEGDVTVDVGGETVQ--L
24600|hp|hbo      MSPWVATTNLWVVEAHGAYARFTVSAGDGA-----VPTTYVRDGSVVRLDVDGDGSREAI
1185|hp|hwa       FNPWVATVNLWIVDIRGAYGRFAVGTASGSMQ-------YVRDGSAVSLDIDGDGTAETL
                     * :* * * *   * * ** : :  *          * *.   .     ..     :

11|hp|hut         GRVEPINFTGRSLLIVITPTG-VGVGDTDGENPECSPTYPAVGVVDTDGNSCTRFGQGGG
2371|hp|hhi       GTADRVSFSADTGVVVVVPPKPRGVGDKGGTAVEESSGWPHAGT----------------
11853|hp|hma      GTADRVSFRAETGVVVVVPPKPRGVGDKGGNGVEESSGWPDAGS----------------
5214|hp|nph       GSGERVSFRTETAVVVVVPPGPRGVGDTDGTIDERAAGWPP-------------------
190|hp|hla        GKTEPIAFEAETVVAVAVPAGPPGVGDVDGTRDERSGGWPCPGA--MGESPSGGEGKCSK
24600|hp|hbo      GSNERIGFELRTVVVAAVPPGGNGVGDIDGDAFETSEAWSGSAP---GPRCDTPTGRCPR
1185|hp|hwa       GRNERIDFTVRTATVVVVPSGPFGVGDVDGNMDERSVGWTGAGA---DAQCTTPTGYCPP
                  *  : : *   :   . .*.   **** .*   * :  :.                    

11|hp|hut         -
2371|hp|hhi       -
11853|hp|hma      -
5214|hp|nph       -
190|hp|hla        P
24600|hp|hbo      E
1185|hp|hwa       E