HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0106COG0463KOG2978 KOG2977arCOG00894Glycosyltransferases involved in cell wall biogenesisglycosyl transferase-like

HOG Organism Gene ID Name Annotation
cHOG0106 nrc1 VNG1053 gtl glycosyl transferase-like
cHOG0106 hmu HMUK2490 Hmuk_2490 glycosyl transferase family 2( EC:2.4.1.83 )
cHOG0106 hma RRNAC0419 gtl glycosyl transferase-like
cHOG0106 hwa HQ2694A gtl glycosyltransferase ( dolichyl-phosphate beta-D-mannosyltransferase)
cHOG0106 hla HLAC0696 Hlac_696 glycosyl transferase family 2
cHOG0106 hbo HBOR17210 Hbor_17210 glycosyl transferase( EC:2.4.1.83 )
cHOG0106 hut HUTA0532 Huta_0532 glycosyl transferase family 2
cHOG0106 hvo HVO_1517 HVO_1517 gtl glycosyl transferase-like
cHOG0106 nph NP3366A glycosyltransferase
cHOG0106 nph NP4658A gtl_1 glycosyltransferase 1 ( dolichyl-phosphate beta-D-mannosyltransferase )
cHOG0106 hhi 1214 gtl2 glycosyltransferase-like protein
cHOG0106 hhi 7 HAH_0007 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


7|hp|hhi            ---MIFGLIGLLFNIVTFPGILVNNVVQGVFNQKYNVPAARLAVDKGIDLDEVENTEEAM
1053|gene|nrc1      -MSEEYEEVCALVPTRN-EAATIADVIDGLFEVGVG---HVLVVDGNSADDTAAVAAEHG
2694|gene|hwa       --MASFDDVTVLVPTYN-EAETVGQVVDDFQEAGFD---DILVIDGDSTDGTQRVAANHG
17210|gene|hbo      ---MDYDDVCILIPTYN-EAETIGGVVSDYHSEGFE---NILVIDGGSDDETVDIAEDRG
696|gene|hla        --MSEYDDVCVLLPTMD-EVETVARVVEAFRNAGLD---GVLVIDGGSTDGTQEAAREAG
3366|gene|nph       MRMPDRTDVCVLLPTLN-ESETIGDVVGGFYDHGFE---HVLVVDGDSTDGTRAIAREHG
4658|gene|nph       MRMPDRTDVCVLLPTLD-EAETIGDVIEGFHEEGFE---HVLVVDGDSTDGTRAIAREHG
532|gene|hut        --MHTRDDVCVLIPTYN-EAAAIGDVIDGFQAEGLE---NVLVIDGGSRDDTQEIAAEHG
10419|gene|hma      --MADRDDVCILLPTFN-EAETIESVVSGFREQGFD---NILVIDGGSTDGTQDRAESAG
1214|gene|hhi       --MADRDDVCILLPTFN-EAETIESVVSGFREQGFD---DVLVIDGGSTDGTQDIAESAG
                            :  *.         :  *:              *.:* .        : .  

7|hp|hhi            ARVSRVLADGEDPGEGERLEQFTNYHGVKPYRTLF-----------GVILGPFF------
1053|gene|nrc1      AEV----VQQSGDGKGQAVREGVS-LIEAAYVLLLDGDGTNPPAQASRLLDPLVAGEAEH
2694|gene|hwa       ARV----VTQSGTGKGQAVREAVERYIDRTYVLMLDGDATYHTDDAEGMLEPLFDGSAAH
17210|gene|hbo      ARV----VMQSGSGKGQAIREAVEYHIEAPYVLMLDGDATYCAKDADTMLEPLDEG-YEH
696|gene|hla        ARV----VEQSGRGKGQAVREAVRDHIDAPYVVMADADATYDAGDVDAMLDPLLSGEAVH
3366|gene|nph       ARV----ITQSGSGKGQAVREGVE-QIDQPYVLMADGDGTYRPEDADKMLTPLFAGRAEH
4658|gene|nph       ARV----ITQSGSGKGQAVREGVE-QIDQPYVLMADGDGTYRPEDADKMLTPLFAGRAEH
532|gene|hut        ARV----VEQSGSGKGQAVREAFE-YIDAPYVLMVDGDGTYRPADADALLEPLLSGDADH
10419|gene|hma      ARV----VEQSGSGKGQAVREAVTRHIEQPYVLMADGDETYRPDEADRLLEPLLSGQADH
1214|gene|hhi       ARV----VEQSGSGKGQAVREAVTRHIEQPYVLMADGDATYRPDEADRLLKPLLSGQAAH
                    * *       .. *:*: : :        .*  :              :* *:       

7|hp|hhi            ------------VMSTLALV-------LFTGAVGLEIVGVVGD-----GDGLVWFASIYP
1053|gene|nrc1      VVGDRTADMRPGAMSTLNQIGNRLINRAFHRIHGEDYGDILSGYRAFTAESFDRMFLSAE
2694|gene|hwa       VVGDRFADLREGAMTRFNQVGNSIINRGFRAVHGDQIRDVLSGYRAFTRASFREMTLTAD
17210|gene|hbo      VIGDRFADMHDGAMTRFNQLGNRIVNRAFATIHGHDFEDILSGYRAFTRDSFGRMTLTAD
696|gene|hla        VIGNRFADMRPGAMTQLNRIGNRLINLSFRAIHGEQYRDILSGYRAFTRESFRRLHLTAD
3366|gene|nph       VIGDRFADMEAGAMTRLNAVGNRLINRLFATIHGRDLQDILSGYRAFTTQSFERSKLSAD
4658|gene|nph       VIGDRFADMEAGAMTRLNAVGNRLINRLFATIHGRDLQDILSGYRAFTTQSFERSQLSAD
532|gene|hut        VIGNRFADMESGAMTRLNRVGNRLINRAFAGIHGRNFVDILSGYRAMTRDSIERFDLTSA
10419|gene|hma      VIGNRFADMRPGAMTKLNQVGNRIINSAFETIHGRDLTDILSGYRAFTRQSFQRSSLTAS
1214|gene|hhi       VIGNRFADMQPGAMTKLNQIGNRIINRAFETIHGRDLTDILSGYRAFTRQSFQRSSLTAS
                                .*: :  :        *    * :  .::..       .:        

7|hp|hhi            GFVVAA--------HAFPNQGPTSALWDRSRETGSLLRVVGYPLALLSMLFSLLE----F
1053|gene|nrc1      GFGIETEMAVECSRHNITTRVVPTTYRARPDDSETNLHPISDGARIILTLYSLAKTSNPL
2694|gene|hwa       GFGIETEMAVECARRDIPTAVVPITYYPRPSGSDTNLRPVRDGGIIFLELFRQAKTNNPL
17210|gene|hbo      GFGIETEMSVECVKRNIETTVVPITYRPRPSGSDTNLRPIRDGGIIFLELYRRAKTNNPL
696|gene|hla        GFGIETEMAVECVKNRQSVAVVPITYRERPGGSATNLHPIRDGGVIFLELYRKAKTNNPL
3366|gene|nph       GFGIETELAVECVRRGVSTAVVPIRYEARPGGSETNLHPLKDGGRILLTLYRLARMNNPI
4658|gene|nph       GFGIETELAVECVRRGVSTAVVPIRYEARPGGSETNLHPLKDGGRILLTLYRLARMNNPI
532|gene|hut        GFGIETELSVECVKHNITTEVVPIRYESRPEDTETNLRPFRDGAVILLTLYRMAKTNNPL
10419|gene|hma      GFGIETEMAVECVKHNISTAVVPITYQPRPDESDTNLRPFRDGATIILTLYQMAKTNNPL
1214|gene|hhi       GFGIETEMAVECVKHNVSTAVVPITYQPRPDESDTNLRPFRDGATIILTLYQMAKTNNPL
                    ** : :        .       .     *.  : : *. .     ::  *:        :

7|hp|hhi            LWIDAL-------------YALLLYWTVGIPLGVVG------------------------
1053|gene|nrc1      FYFGSIGAGFGTLGVALAGYVAYDWLLHGVSHEVIALVAGVSVLFGVQLLMFGLLSDLIV
2694|gene|hwa       FYFGSVGALSTLTGLGVAVYVIVEWITVRVPHEILAVVAAAGVLFGVQLLMFGVLADLIY
17210|gene|hbo      FYFGSVGGLSTAIGIGIALYVAIEWVTVNTSHEVLAVVAAAAILFGVQLLMFGVLSDLIL
696|gene|hla        FYFGSLGAISTSAGALMTGYVLYDWIVNGIPHEIIAIGAVGAATLGIQLLIFGFLADMIL
3366|gene|nph       FYFGSVAAVGTAGGVALGAFVGYRYLTAGVSHEVLALLAAFLVLLSVQLLMFGVLSDIIV
4658|gene|nph       FYFGSVAAVGTAGGVALGAFVGYRYLTAGVSHEVLALLAAFLVLLSVQLLMFGVLSDIIV
532|gene|hut        FYFGSVGTASLLVGALLGVYVAVEWFTRNISHEVIALVAAVGIIFGVQLLVFGVLSDMIV
10419|gene|hma      FYFGSVGLGSTVVGFLLGAYVAYDWVVNSISHEVIAVVGSFAILLGIQLLMFGVLSDMLV
1214|gene|hhi       FYFGSVGLGSTVVGFLLGAYVAYDWVVNSISHEVIAVVGSFAILLGIQLLMFGVLSDMLV
                    :::.::             :.   :     .  ::.                        

7|hp|hhi            ------------------------------------------------------------
1053|gene|nrc1      TLHREQTRRIERLNK---------------------------------------------
2694|gene|hwa       SLHSETMSRIGSVVEMDRTEQTVGGISRERDIDTDRKPDAHGSTIQPSHTDANDTLGSTT
17210|gene|hbo      SLHRDTLRKIDEETGTNADQTPDSGSNSNSGSTRPRGVRQDGGDEAETTDRSASN-----
696|gene|hla        SLHREQVARYERAVDDGSDR----------------------------------------
3366|gene|nph       SIHREQTRRLDDIADQLEEQNDE-------------------------------------
4658|gene|nph       SIHREQSRRLDDIADQLEEQNDE-------------------------------------
532|gene|hut        KLHREQMHRLDQVLDADRKTEDGSRD----------------------------------
10419|gene|hma      AVNREQTRRLEDIAVQLTHESHSQPADVFDDQQVS--------GAEGIEDSDTETEPAVS
1214|gene|hhi       AVNREQTRRLEDIAVQLTHESRSRPVDVFDDQRVGDAEHGKKGDAEDTGDSDIETEPAVS
                                                                                

7|hp|hhi            -------------------------------------------------
1053|gene|nrc1      -------------------------------------------------
2694|gene|hwa       SSDVSEEDATNKKATIPTELDKTQHEDSVVTKEDIDTEDGSTQTHGSDS
17210|gene|hbo      ---PDD-------------------------------------------
696|gene|hla        -------------------------------------------------
3366|gene|nph       -------------------------------------------------
4658|gene|nph       -------------------------------------------------
532|gene|hut        -------------------------------------------------
10419|gene|hma      PHQSDE-------------------------------------------
1214|gene|hhi       SHSSDE-------------------------------------------