HOG Organism Gene ID Name Annotation
aHOG1055 hhi 690 HAH_0690 transcription regulator
aHOG1055 hhi 343 pspA transcription regulator
aHOG1055 hbo HBOR09390 Hbor_09390 phage shock protein A (IM30), suppresses sigma54- dependent transcription
aHOG1055 hla HLAC1621 Hlac_1621 phage shock protein A, PspA
aHOG1055 hmu HMUK1391 Hmuk_1391 phage shock protein A, PspA
aHOG1055 hmu HMUK1765 Hmuk_1765 phage shock protein A, PspA
aHOG1055 hut HUTA0429 Huta_0429 phage shock protein A, PspA
aHOG1055 hwa HQ3029 pspA stress response protein
aHOG1055 nph NP2412 pspA stress response protein
aHOG1055 hma Hma_13089 pspA2 transcription regulator
aHOG1055 hma Hma_13467 pspA1 transcription regulator
MUSCLE (3.6) multiple sequence alignment


343|gene|hhi        ---MSLLQRFAFAIRAKLNALLSRTSDPAAELDYSYEQMRDELQDVTRGIADVTTQKKRL
13089|gene|hma      ---MSLLRRFAFAIRAKLNALLNRTSDPTAELDYSYEQMRDELQDVTRGIADVTTQKKRL
1621|gene|hla       MAGMGILSRASYVIRSKLNALLNRTEDPTESLDYSYEQMRDELQDVKQGIADLTTQKKRL
3029|gene|hwa       ---MGILSRASYVVRSKLNSLLNRAEDPTETLEYSYEQMRDELQEVKQGIADLTTQKKRL
9390|gene|hbo       ---MGILSRASYVVRSKINSLLNRAEDPTETLDYSYEKMRDELQQVKQGIADLTTQKKRL
429|gene|hut        ---MGILSRASYVIRSKVNSLLNRAENPSESLDYSYEQLRDELQDVKQGIADLTTQKKRL
690|gene|hhi        ---MGILSRASYVIRSKLNAVLNRAEDPTETLDYSYEQLRDELQDVKQGIADLTTQKKRL
13467|gene|hma      ---MGILSRASYVIRSKLNAVLNRAEDPTETLDYSYEQLRDELQDVKQGIADLTTQKKRL
2412|gene|nph       ---MGILSRASYVIRSKINAVLNRAEDPHETLDYSYEQLRDELQDVKQGIADLTTQKKRL
                       *.:* * ::.:*:*:*::*.*:.:*   *:****::*****:*..****:*******

343|gene|hhi        EIHRTRLRSNVEKHDTQARAALQEGRDDLARRALGKKQVNVSQITDLTGQIDDLQETQDR
13089|gene|hma      EIHRTRLRSNVEKHDTQARAALQEGRDDLARRALEKKQVNVSQITELTGQIDDLQETQDR
1621|gene|hla       EIQKRKLDENVEKHNRQAREAVQQDRDDLARKALEKKKSKMTQIEELEGQIAKLNDTQEQ
3029|gene|hwa       EMQKRRLEENVEKHNEQAREAVRQDREDLARQALEKKQAKMSQIEDLEAQVSELQSTQDD
9390|gene|hbo       EIQKRRLEENVEKHNEQARQAVRQDRDDLAKRALEKKQAKMNQIEDLESQIANLQETQDN
429|gene|hut        EIQKRRLEENVEKHNDQAREAVEQGRDDLARRALEKKKQKMNQIEDLETQVADLQGQQDR
690|gene|hhi        EIQKRRLEENVEKHNEQARQAVEQDREDLARQALEKKKQKMSQIEDLEGQIQDLQSQQDQ
13467|gene|hma      EIQKRRLEENVEKHNEQARQAVEQDREDLARQALEKKKQKMSQIEDLEGQIQDLQSQQDQ
2412|gene|nph       EIQKNRLEENVEKHNEQARQAVEQGRDDLARRALEKKKQKMQQIEDLETQIADLQNTQDN
                    *::. .* .*****: *** *: :.*:***..** **: :: ** :*  *: .*:  *: 

343|gene|hhi        LVGKRAELSSQIEQFRTKKETMKARYQAAEASARVSEAFTGAGDTMADVHRSIERATERT
13089|gene|hma      LVGKRAELSSQIEQFRTKKETMKARYQAAEASARVSEAFTGAGDTMADVHRSIERATERT
1621|gene|hla       LVEKKNKLQNRIEEFRTKKESMKARYQAAEASSRVSEAMTGVGDEMEDVSRSIERAEERT
3029|gene|hwa       LVEQKNELQNRIEEFRTKKETMKARYEAAEASSRVSEAMTGVGDEMNDVSRAIDRAEQET
9390|gene|hbo       LVDKKNELQNRIEEFRTKKETMKARYEAAEASSRVSEAVSGVGDEMGDVSRALERAEDQT
429|gene|hut        LIEQKNELQSQVEQFRTKKETMKARYQAAEASSRVSEAMTGAGDQFEDVGRAIERAQEQT
690|gene|hhi        LVEQKDELQKQIEQFRTKKETMKARHEAAKASARVNEAMTGAGDEMQDINQAIERAEERT
13467|gene|hma      LVEQKDELQKQIEQFRTKKETMKARHEAAKASARVNEAMTGAGDEMQDINQAIERAEERT
2412|gene|nph       LVEKKNELQNRIQEFRTEKETMKARYEAAEASARVSEAMTGAGEEMENINRSIERARDDT
                    *: :. :*...:::***:**:****::**:**:**.**.:*.*: : :: .:::** : *

343|gene|hhi        EQMEARAAALEELEESGQLESVLDDGDSIDQELDRLSSERAVENELATLRAEMDERE---
13089|gene|hma      EQMEARAAALEELEASGQLESVLDEGDSIDQELDRLSGERAVENELATLRAEMDNGK---
1621|gene|hla       EDMEARAEAMDELEDSGAFEDALSDKDSIDRELDSLSTNSEVDAELETLKGELGKGEPAS
3029|gene|hwa       DEMEARSEAMDELADTGAFDEAISDKDKIDRELSSGRTDAAVDSELATLKSDVDGGT---
9390|gene|hbo       DEMEARSAAMDELVDTGAFDEMMSDKDAIDRELETGRANSEVDTELETLKTEMGKST---
429|gene|hut        EEMEARSAAMDELRDSGAIDDAISDQDQLDRELEEVRTSGAVDAELETLKSEVGDES---
690|gene|hhi        EDMEARSQAMDELREDGVLESQISDESSLERELEEVRQKGSVDAELDTLKAEMGKAE---
13467|gene|hma      EDMEARSQAMDELREDGVLESQISDESSLERELEEVRQKGSVDAELDTLKAEMGKAE---
2412|gene|nph       EDMEARAAAMDELEESGAFDSALSNESDLEAELEEVRQEGEVEAELETLKADAGVES---
                    ::****: *::**   * ::. :.: . :: **.    .  *: ** **. : .      

343|gene|hhi        ---------------------------------------AVEEAAE-----------
13089|gene|hma      ---------------------------------------AVEEATE-----------
1621|gene|hla       DDAGESTDEEIDTELADIESEIDSDDLEADLDGDDDADEEVDVELEESEVDADEQRN
3029|gene|hwa       --EETSSTTAESEGENKTNSE-----SETSVS-----DPAVETELEELRDDENN---
9390|gene|hbo       --AEAESEAESENGSETASADLDEELDEVDVA-----EEDVEAELEELKNEDDS---
429|gene|hut        --GDEDAEADTEADTADVDL--------GDVE-----DAAVEEELETLKDEES----
690|gene|hhi        --DGDSGSSDADVSEAELEKELTDESTQVDVD-----ESEVESELDELKEDEK----
13467|gene|hma      --DGDSGSSDADVSEAELEQELADESTQVDVD-----ESEVESELDELKEDEQ----
2412|gene|nph       --DGEADPEVELEETNEAAA-----------------DPEIEAELDDLKKDDE----
                                                            ::   :