HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0105COG0460KOG0455arCOG01351Homoserine dehydrogenasehomoserine dehydrogenase

HOG Organism Gene ID Name Annotation
cHOG0105 nrc1 VNG2650 hom homoserine dehydrogenase
cHOG0105 hmu HMUK0498 Hmuk_0498 Homoserine dehydrogenase( EC:1.1.1.3 )
cHOG0105 hma RRNAC2408 hom homoserine dehydrogenase
cHOG0105 hwa HQ3386A hom homoserine dehydrogenase
cHOG0105 hla HLAC0155 Hlac_155 homoserine dehydrogenase
cHOG0105 hbo HBOR28120 Hbor_28120 homoserine dehydrogenase( EC:1.1.1.3 )
cHOG0105 hut HUTA0812 Huta_0812 Homoserine dehydrogenase
cHOG0105 hvo HVO_0358 HVO_0358 hom Homoserine dehydrogenase
cHOG0105 nph NP0302A hom homoserine dehydrogenase
cHOG0105 hhi 2842 hom homoserine dehydrogenase
MUSCLE (3.6) multiple sequence alignment


2650|gene|nrc1      ----------MRLAVMGAGAVGQAVVDQAASHGHTVVAVADSTSAVVD------GSGVDA
812|gene|hut        ----------MDLAIMGTGTVGSSVADLASEYGHRVTAMANVDAAAID------PDGIDT
3386|gene|hwa       MADPQSRTTGKRLAVVGAGAVGGAVVDLASEYGHTITAFADSTSAAID------PNGIDT
28120|gene|hbo      -------MSGKRLAVLGAGAVGGSVVELAESYGHTVTAFADSASAVVD------ADGIDP
12408|gene|hma      ----------MKLAVIGAGAVGSSVVELASDHGHSVTAFADSSSAVID------SAGIDT
2842|gene|hhi       ----------MRLAVIGAGAVGSSVVELASDHGHSVTAFADSSSAVID------SAGIDT
155|gene|hla        ----------MKLAVIGAGAVGRSVVDLAGEYGHEVVAVADSSSAVVADGSDGRDAGVDS
302|gene|nph        ----------MKLSVLGSGAVGAAVVELAGEYGHEVVAVADSASAAVD------ESGLDA
                                *:::*:*:** :*.: * .:** :.*.*:  :*.:         *:*.

2650|gene|nrc1      AAVCARKRDAAS-EIGTGAPSDALAADYDVLVEATPTTLGDAEPGFGHVERALSADRHVV
812|gene|hut        AGALERQRSEGMAHLGDADPDDVLAAEYDALVEVTPVTLGDAEPGFSHVEAALERDRHVV
3386|gene|hwa       DAVLTRKDETGT--VGESDSSVAVDATYDVLIEATPTTLGDAQPGFSHLRTALERDRDVV
28120|gene|hbo      ASVLKQKHDEGR--VGSADPESALHADYDVLVEATPTTLGDAEPGFSHVRHALERGADVV
12408|gene|hma      AAVLDRKRTDGV--VGSGAPEDALSAEYDVLVEATPTTLGDAEPGFGHIQAALERDRHAV
2842|gene|hhi       AEVLDRKRTDGV--VGSAAPEDALSAEYDVLVEATPTTLGDAEPGFSHVQAALERDRHAV
155|gene|hla        DAVVARKAERGI--VGDDDPDDALAADYDALVEATPTTLGDAEPGFSHVRTALERDRHAV
302|gene|nph        EAVLERKRTDGR--VGDADADAALEADYDVLVEATPTTLGDAEPGFSHVKQALERDRHVV
                      .  .:   .   :*   .. .: * **.*:*.**.*****:***.*:  **. .  .*

2650|gene|nrc1      LANKGPVAERYAGVCELAAASAGSLRFEATVGGAIPVLATIERIGADRVRAVRGVLNGTA
812|gene|hut        LANKGPMAERYADVRALEAESEGEVRFEATVAGAIPVLSTIEDYGPGTMTAVRGVFNGTA
3386|gene|hwa       LANKGPVAERYADVQQVLHDSDGSLRFEATVGGAIPVLSTLEDISPAQVTAVRGVLNGTA
28120|gene|hbo      LANKGPVAERYADLMALERENAGSVRFEATVGGAIPVLSTIEDLSPEHVTAARGVLNGTA
12408|gene|hma      LANKGPVAERYADVRALERESEGNVLFEATVGGAMPILSTIDDFDPSHITAVRGVLNGTA
2842|gene|hhi       LANKGPVAERYADVRALERESEGSVLFEATVGGAMPVLSTIDDFDPSHITAVRGVLNGTA
155|gene|hla        LANKGPVAERFGDLRALVADSAGDIRFEATVGGAIPAVSTVEDIEPGHVTAVRGVLNGTA
302|gene|nph        LANKGPVAERYDELRSLEADSAGSVRFEAAVGGAIPILSTIADLD-GQVTAARGVLNGTA
                    ******:***:  :  :   . *.: ***:*.**:* ::*:       : *.***:****

2650|gene|nrc1      NFVLSRMAAAGLEYEHVLAEAQEVGVAEADPTFDVDGTDAALKCAILANVIG--------
812|gene|hut        NFILTRMAAEGLGYEHVLAEAQDLGVAEADPAFDVEGTDAALKCVILANVLA-------Q
3386|gene|hwa       NFILSRMATEGINYEHVLAEAQDLGVAEADPAFDVEGTDAALKCVILANVLS-------T
28120|gene|hbo      NFVLSRMATEGLDYEHVLAEAQDLGVAEADPSFDVEGTDAALKCVILSNVLA-------E
12408|gene|hma      NFILSRMATEGLDYEHVLAEAQDLGVAEADPTFDVDGTDAALKGVIIANVLS-------D
2842|gene|hhi       NFILSRMATEGLDYEHVLAEAQDLGVAEADPTFDVDGTDAALKGVIVANVLA-------D
155|gene|hla        NFILTRMAAEGLDYDHVLAEAQDLGVAEADPSFDVDGTDAALKCVILANVLSFGAADDPD
302|gene|nph        NFILSRMAAEGLGYEHVLAEAQDLGVAEADPTFDVEGTDAALKCVILANVLY--------
                    **:*:***: *: *:*******::*******:***:******* .*::**:         

2650|gene|nrc1      -DREYDLDGVSVDGITGVAPSALELAETDGQTIRLIGEVGPDHVRVGPRLVPANGTLAVS
812|gene|hut        GDREFSLEDASVEGIKDIPGSALELAREDGRTIRLIGEVTGDEIRVSPRLVPEHSELAVS
3386|gene|hwa       DNREYTLADATVDGITNIPGSALELAAEEGRTIRLVGEATPTGVHVGPRLIPQNTALAVT
28120|gene|hbo      GEREYTLADANVEGITNIPGSALELAAEDGQTVRLIGESTPDRVRVSPRLVPQNTALAVS
12408|gene|hma      DETEYTLDDAEVTGIQEISGSALELARADGRTVRLIAEVVEGSVRVGPRLVPDNAPLAVS
2842|gene|hhi       DETEYTLDDAEVEGIQDISGSALELARADGRTVRLIAEVVEGSVRVGPRLVPDNAPLAVS
155|gene|hla        DAREFSLDDAAVEGIRDVPGSALRLAAEDGRTVRLIGEATEETVRVAPRLVPENGTLAVS
302|gene|nph        -EDTYTLEDASVEGIADLPGSALELAAEDGRTIRLIGDVSDGEVSVAPRLVPENGTLAVS
                        : * .. * **  :. *** **  :*.*:**:.:     : *.***:* :  ***:

2650|gene|nrc1      GTTNIVQLETEHAGRLNLSGQGAGGAATASAVLADVDHIADQQ
812|gene|hut        GTTNIVQLETDNAGRLNLSGRGAGGPETATAILADVNRLPEP-
3386|gene|hwa       GTRNIVQLETTNAGQLNLSGRGAGGPETASAILADVSRL----
28120|gene|hbo      GTRNIVQLETKHAGQLNISGRGAGGPETASAVLADIGRLD---
12408|gene|hma      GTRNIAQLETEHAGQLNISGRGAGGPETASAVLADIGRL----
2842|gene|hhi       GTRNIAQLETEHAGQLNISGRGAGGPETASAVLADIGRL----
155|gene|hla        GTQNIVQIETTHAGRLNISGRGAGGPETASAVLGDVGRLQ---
302|gene|nph        GTLNIIQLETAHAGQLNISGRGAGGPETASAVLADVGRLPPLE
                    ** ** *:** :**.**:**.****. **:*:*.*:..: