HOG Organism Gene ID Name Annotation
aHOG1049 hhi 3055 HAH_3055 exonuclease-like protein
aHOG1049 hbo HBOR16060 Hbor_16060 predicted exonuclease
aHOG1049 hla HLAC1783 Hlac_1783 hypothetical protein
aHOG1049 hmu HMUK1001 Hmuk_1001 conserved hypothetical protein
aHOG1049 hut HUTA1457 Huta_1457 conserved hypothetical protein
aHOG1049 hwa HQ2624 hypothetical protein
aHOG1049 nph NP5114 hypothetical protein
aHOG1049 nrc1 VNG1213 exo predicted exonuclease
MUSCLE (3.6) multiple sequence alignment


1213|chp|nrc1      MSAAQQTYVHRSACRSGGRASDIGWPLPTATFDRLHCHATATRRPTSECAPDTERSAPRT
1457|chp|hut       ------------------------------------------------------------
5114|hp|nph        ------------------------------------------------------------
3055|gene|hhi      ------------------------------------------------------------
2624|hp|hwa        ------------------------------------------------------------
16060|hp|hbo       ------------------------------------------------------------
1783|hp|hla        ------------------------------------------------------------
                                                                               

1213|chp|nrc1      RPETALPMCQPPQAVDMRVENSFLPAAGVGERTERRLWQHGVTHWTDFDGD--GPGIGDA
1457|chp|hut       ----------------MRVEQSFIPVRGVGEQTERKLWRQGITHWDDFYPD----AVGST
5114|hp|nph        ----------------MRLENTYIAVDGVGETTERELWASGARTWSEFDPS----LCGPT
3055|gene|hhi      ----------------MRVENSFIGTDGVGEKTERSIWEQGVTHWDEFEPS----VVGGQ
2624|hp|hwa        ----------------MRIENSFIPVSGVGESRERSLWEADIISWERFDPT--DAPVGPK
16060|hp|hbo       ----------------MRIENSFIPVHGVGERTERSLWEEGVLTWEAFDPS--VAPVGEK
1783|hp|hla        ----------------MRIENSFIPVEGVGETTERRIWREGVTTWESFDPAVDVAGVGST
                                   **:*:::: . ****  ** :*  .   *  *         *  

1213|chp|nrc1      TAENIYSFIDAAERALDAGNTSFFADALPSGELWRLYENVADDVAFFDIETTGLDQHSSV
1457|chp|hut       TAERIETFIDDARERLAHGDSHYFGRQFPSQAQWRLYESFQDGAAFFDIETTGLDQRHDT
5114|hp|nph        TADRIESFIEQARPRLDADDSAFFDRQLPSSERWRLYENFRDEACFFDIETTGLDQMRDT
3055|gene|hhi      RGDRIQQFIDEGRDRVAETDVSYFDHAFPSSERWRLYETFRERACFFDIETTGLDQDRNQ
2624|hp|hwa        TATAIESFLAEALPRLDDGDTQYFNEQFPDSEIWRLYENTRTETVFFDIETTGLDAGYND
16060|hp|hbo       TGQRIETFVADALERLDDGDARYFGDAFPSGERWRLYENFREDTCFFDIETTGLDSAQND
1783|hp|hla        TADRIESFIAEALTHLDDGDSAYFDRTFPSGERWRLYENFREETCFFDIETTGLDEHRDR
                    .  *  *:  .   :   :  :*   :*.   *****.    . **********   . 

1213|chp|nrc1      VTTVSVHRGGDTTTLVRGSDLTAERL-QALLDAPMVASFNGKRFDAPFLEHHFDLS--LD
1457|chp|hut       VTTVSVRQGGETKTFVRDRDLTADRLREVFADADLLVSFNGKRFDVPFLQQSFDLDGVLD
5114|hp|nph        VTCVSIHQGGETETLVRGDDLTQGNL-EALLDGPLLISFNGARFDVPFLETAFDID--IE
3055|gene|hhi      VTTVSLHQDGETQTLIAGDDLTAENLRAAFDGADLLVTFNGKRFDVPFLEANFDVN--LD
2624|hp|hwa        VTTVSFHQQDETTTLVRGDDLTRNRVREQFRTAPLIASFNGKRFDVPFLEQCFDIS--IE
16060|hp|hbo       VTTVSFHRDGETTTLVRGHDLTAEALREQFTDAALVASFNGKRFDVPFLEDNFDIS--ID
1783|hp|hla        VTTVSFHRDGETTTLVAGEDLTAERLREQFADASLLATFNGARFDVPFLETAFDIE--ID
                   ** **... .:* *:: . ***   :   :  . :: :*** ***.***:  **:.  ::

1213|chp|nrc1      SPHLDLMYPCRRLDLTGGLKQVERDLGVDRAEVDDVDGREAVRLWRRYAEDNDEAALDRL
1457|chp|hut       RPHLDLMYPCRQIDLTGGLKQIEKDVGIQR-DRPDLSGKDAVRLWYEAER-GDDAALETL
5114|hp|nph        APHLDLMYPCKRVGLTGGLKAIEPEVGVER-DRPDLSGKDAVRLWRDHER-GVDGALETL
3055|gene|hhi      RPHLDLMYTCKKIGLSGGLKQVEQDIGIER-DRPDISGRDAVRLWREHEQ-GRDGALETL
2624|hp|hwa        TPHLDLMYPCRRVNLTGGLKSIENEIGIDR-DRPDLSGRDAVRLWSQYKRSNDTDALETL
16060|hp|hbo       TPHIDLMYPCRRLDLTGGLKSIEKAVGIDR-DRPDLSGRDAVRLWHQYERDGDEDALDTL
1783|hp|hla        TPHLDLMYPCKRIGLSGGLKPIEKEIGIER-DRPDLSGRDAVRLWREYER-GDDDALDTL
                    **:****.*..:.*:**** :*  :*::* :  *:.*.:*****      .   **: *

1213|chp|nrc1      VTYNQYDTQNLQAILDAVAERLHRDVFEPHV------------
1457|chp|hut       ISYNREDVDHLETVADRVATRLHESTVPDDCTF----------
5114|hp|nph        ISYNREDTVNLKTVADSAVERLDRKLLP---------------
3055|gene|hhi      VSYNREDTVNLKTLAETATERLDEQVFVG--------------
2624|hp|hwa        ISYNRDDTVNLRNLADVVARTLHEQS-LGAATGTPCGIADPRE
16060|hp|hbo       VSYNRDDTANLSNLMDVVVESLHADS-IGPFLE----------
1783|hp|hla        VSYNREDTKNLRTLADTVTETLHEDVFVGETVER---------
                   ::**. *. :*  : : ..  *  .