HOG Organism Gene ID Name Annotation
aHOG1048 hhi 2075 HAH_2075 TatD-related deoxyribonuclease
aHOG1048 hbo HBOR08490 Hbor_08490 predicted metal-dependent hydrolase (urease superfamily)
aHOG1048 hla HLAC1934 Hlac_1934 TatD-related deoxyribonuclease
aHOG1048 hmu HMUK1878 Hmuk_1878 TatD-related deoxyribonuclease
aHOG1048 hut HUTA2749 Huta_2749 TatD-related deoxyribonuclease
aHOG1048 hwa HQ2866 metalloenzyme, TatD related DNAse
aHOG1048 nph NP4780 hypothetical protein
aHOG1048 nrc1 VNG1610 vng1610 no entry
MUSCLE (3.6) multiple sequence alignment


1610|chp|nrc1      -MSEFDQPVLDDHLHLDAEN-QGLDAVRDFARAGGTHLLVVNKPSWHLGVEPDTGADFRP
4780|hp|nph        ---MYDGPILDNHLHLDPVNGRGADAAAEFADAGGTHLNVLNKPSWNLVGEVDDEDGFRE
2866|gene|hwa      -MDSLKTPILDNHLHLDPEHGQGIDAVKDFIQMGGTHLLVVNKPSWHLGINPTSGSDFDA
8490|hp|hbo        -MEALDTPVLDNHLHLDPRYGRGIDAVDDFRRLGGTHLLVVNKPSWHLDVEASEGGDFRA
1934|gene|hla      MTDDLDTPVLDNHLHLDPRHGRGVDAVKDFVRLGGTHLLVVNKPSWHLGVEPDEPTDFRP
2075|gene|hhi      -MDIDDTPVLDNHLHLDPVNGRNVAAAEEFASQGGTHLLVLNKPSWHLVEKATAAETFRE
2749|gene|hut      MTDEPDTPILDDHLHLDPAHGRGIDAVEDFVNAGGTHLLVVNKPSWMLEDVGDDESIFRA
                        . *:**:*****.   ..  *. :*   ***** *:***** *         *  

1610|chp|nrc1      VFEETARLVEAAREILDGEAWPVLGVHPGLVSRLVEERGFSPGEARDLMCAGIDAAAAVA
4780|hp|nph        TFDITIDVTAAADELLPGRAWPVLGVHPALISQLVD-RGYGPEEAAELMCAGIDVAAEYV
2866|gene|hwa      VFETTIDIVETASEILPGRAWPVLGVHPGLISRLVDERSYDPETAAELMCAGLDRAASYV
8490|hp|hbo        VFEETITTVEEASEALPGRAWPVLGVHPGLVSRLVDERDFSPAEARDLMQAGLDVAAEYV
1934|gene|hla      VFEETLDAVAAANEVLPGRAWPVLGVHPGLISRLVDDRGFSPEDARDLMQGGIEVASEFV
2075|gene|hhi      VFDLTVEAAAAATEVLDGRAWPVLGVHPALISKLVD-DGYTPPEAMDIMQTGLDVAAEYV
2749|gene|hut      VFETTIDVVERATEVLPGRAWPVLGVHPALISKLTG-RGYTPDEARDIMQAGLDIAAEYV
                   .*: *   .  * * * * *********.*:*.*.   .: *  * ::*  *:: *:  .

1610|chp|nrc1      SEGRAVALKSGRPHYDVSSAVWEASNAVIRHACERAADVGVSLQLHTESTDDLTAVGEWA
4780|hp|nph        ASGRALAIKSGRPHYDVADAVWEASNQVMRHAFARAAEVGCAVQLHTEGGEDFETVAEWA
2866|gene|hwa      QNDTALALKSGRPHYDVSESVWKASNRVMKHAFRLGGEVDCAVQLHTEATDDLTDIAMWA
8490|hp|hbo        RAGDALALKSGRPHYDVPDAVWEASNDVMRHAFSLGAELDCAVQLHTEASDDLTAVAAWA
1934|gene|hla      ADGDALALKSGRPHYDVSDAVWAASNAVTRRAFELGAALDCAVQLHTEASEDLTDLAAAA
2075|gene|hhi      DNGDALAMKSGRPHYDVDDAVWEASNAVMCHGFERAADVGCAIQLHTEGGEDFEAVAGWA
2749|gene|hut      AEGPALALKSGRPHYDVGDPVWEASNDVMKHAFELGAETGCAVQLHTEGGQDFTEVAEWA
                     . *:*:********* ..** *** *  ..   ..  . ::*****. :*:  :.  *

1610|chp|nrc1      SAAGLAPEAVVKHYASGRLSGCTPSVMCDKEYLQDAVGSGERFLMETDFIDDADRPGAVM
4780|hp|nph        EAEGLARKQVVKHYSAGYVDGPIPSVIAHKDELERACGGEWPFFMETDFIDDPDRPGAVL
2866|gene|hwa      EDRGVPAQRVVKHYAGGTLAGPTPSVMSQKDRLETAAIEDEPFLMETDFIDDPDRPGAVL
8490|hp|hbo        EDAGMPRKKVVKHYAGGRLAGPTPSVMSEKDRLETAVERGEPFLMETDFVDDADRPGAVL
1934|gene|hla      EEVGLDPTRVVKHYAEGRLAGLTPSVMSEKDRLERAAESGEPFLMETDYVDDPEKPGMVL
2075|gene|hhi      EDRGLDRMQVVKHYSGGRLRGPVKSVLADKDELEIAVETDEPFLMETDYIDDPDRPGAVL
2749|gene|hut      ENRGLPADRVVKHYSEGRLDGPTKSVLSNKDELEIAVEADEPFLMETDFIDDPDRPGAVL
                   .  *:    *****: * : *   **:. *: *: *      *:****::**.:.** *:

1610|chp|nrc1      GPKTVPRRVRWLLESGHEDAVRRAHVETPAAVYGIDTEATLDG--
4780|hp|nph        GPKTVPKRTRWLAEAGHETALRRAHVETPAQVYGIDTEATLDEN-
2866|gene|hwa      GPKTVPRRVRWLQQNGYETAIEQAHIETPKMIYEIDTESTLASNS
8490|hp|hbo        GPKTVPRRVRWMLDEGWEDAVETAHVETPKDVYGIDTRATLSR--
1934|gene|hla      GPKTVPRRVRWLLEAGYDDAVRRAHVETPRAVYEIDTESTLNRDT
2075|gene|hhi      GPKTVPRRVRWLLENGHEDAVRTAHVETPKAVYGIDTEATLQR--
2749|gene|hut      GPKTVPRRVEWMRAEGYDDAIRTAHVETPAAVYGIDTEATL----
                   ******.*. *:   * : *:  **:***  :* *** :**