HOG Organism Gene ID Name Annotation
aHOG1039 hhi 2440 HAH_2440 putative CobD/Cbib protein
aHOG1039 hbo HBOR26170 Hbor_26170 adenosylcobinamide-phosphate synthase( EC:6.3.1.10 )
aHOG1039 hla HLAC0232 Hlac_232 cobalamin biosynthesis protein CobD
aHOG1039 hmu HMUK0144 Hmuk_0144 cobalamin biosynthesis protein CobD( EC:6.3.1.10 )
aHOG1039 hut HUTA2495 Huta_2495 cobalamin biosynthesis protein CobD
aHOG1039 hwa HQ1411 cbiB cobalamine biosynthesis protein (adenosylcobinamide biosynthesis protein)
aHOG1039 nph NP5308 cbiB cobalamine biosynthesis protein (adenosylcobinamide biosynthesis protein)
aHOG1039 nrc1 VNG1578 vng1578 no entry
MUSCLE (3.6) multiple sequence alignment


1411|gene|hwa       -------MITLGSI------------AVIVAIGLDTIIGEPPAFIHPVALFGQLVDIV-D
5308|gene|nph       -------MNGSGLL-----------LAVAVAAALEALVGEPPARIHPVALLGRAVAPLGE
232|gene|hla        MATAPLLTPVLASL-----------ATLAIAVALDLALAEPPARVHPVALFGSVVGRF-D
2495|gene|hut       -------MTIIAAAPGEFVVRIQPGICVALALALDGAVGEPPESIHPVALFGRMIAPL-D
26170|gene|hbo      -------MPLTAAL------------AVVLAAGLDVAVAEPPARVHPVALLGRLVSHA-D
2440|gene|hhi       -------MSAL---------------AVAVAGGLELAIGEPPTRLHPVAWFGRLVGAV-D
1578|hp|nrc1        -------MTAAAVG------------AVAVGVALDAAIAEPPAGCHPVAWFGRAVGVV-D
                                               : :. .*:  :.***   **** :*  :    :

1411|gene|hwa       RSYDSPNIVGILIATTLPIGFGIVTATSVYVVFSVNSQLGA---FAAGCVLFTLISLRLL
5308|gene|nph       RSFSWPALAGTVAAVGVPAAAAGVAYLTVAAAAALGAAAAA---VTAGLVLWTTTSLRLL
232|gene|hla        RSWSRPRLVGVAVAVGLPIGVAAFAGGIVAAASFALPAFSALPVLVAGTILFTTVSLRML
2495|gene|hut       REWPFSRAVGTSIALAAPLAVAFLAWLLVEFATTV-PVLSS---IVAGLVLFSTLSLRRL
26170|gene|hbo      RTWSHPRLVGVVLALAAPLGFAGVAGGVVAAAETLSPWVGA---LFASLVLFAATSLRML
2440|gene|hhi       REWDHPLAVGALAAALLPLGAATVVGATVALAAGRAPLAAV---ALAGLALFLTTSLRSL
1578|hp|nrc1        RPWTRPLAVGALAAIALPLAAAATVWAAVTVATWGSALAGA---VVAGLVVFVTTSRRML
                    * :  .  .*   *   * . .  .   *  .    .  .      *.  ::   * * *

1411|gene|hwa       LRTVHDVVMMTTAD--VSAARYELRALAGRDASELDAAHIRSAAVESAAENLADGFIGPL
5308|gene|nph       LSSAADVIEASDND--PAAAKAALPALAGRDAASLSPPLLRSAAVESLAENLSDGLVGPL
232|gene|hla        LATTAEVVELTETD--PDAARESVRALAGRDATDLSPADLRSAAVESAAENLADGFVAPL
2495|gene|hut       LTRARDVIDVSRTD--LETARERLPALVGRDPSSLSPPLIRSASVESLAENLADGFVAPL
26170|gene|hbo      LDAVRDVTQAAETD--LDAARTELRALAGRDASALDAAHVRSAAVESVAENLSDGLVAPL
2440|gene|hhi       LSTARGVIADTEAD--LAAARDGLLALAGRDASALSAGEVRSAAVESASENLADGLVASL
1578|hp|nrc1        LAEASGVIAATRTENSLDAARRRLRALAGRDPDALSAGELRSAAVESTAENLADGLVAPL
                    *  .  *   :  :    :*.  : **.***.  *..  :***:*** :***:**::..*

1411|gene|hwa       LAF-------TLFA----PVSVSIGVASAAWVKAINTLDSMLGYRSKPIGTASARLDDII
5308|gene|nph       SAF-------VVLS----FVSLPAAAAAAAAFKAVNTMDSMFGYPGR-FGWASARLDDLM
232|gene|hla        GGFALGATVGLAVGGSEVALPLAAGVAAAVWVKAVNTLDSMLGYRSKPVGWASARLDDAV
2495|gene|hut       LAF-------TLGA----QLSLSVGVAAAVWIKAVNTLDSMLGYRSKPVGWASARLDDLV
26170|gene|hbo      FAF-------AVCA----PFSLPLAAAAAAWVKGVNTLDSMFGYRSKPIGWAPARLDDVV
2440|gene|hhi       AAFVLGGLAAAGVG----LLPLPVAAGTAAWIKAVNTMDSMLGYRSKRVGTPAARLDDAV
1578|hp|nrc1        AAF------AVGAA----VVSLPVGAAAAAWVKAVNTLDSMLGYRSKRVGTASARLDDAV
                     .*          .     ..:. ...:*. .*.:**:***:** .. .* ..***** :

1411|gene|hwa       MWVPARLTAALLSVAAGHPLLPLRQQVRADAAQTASPNAGWPMATIAALLPARLHKPDTY
5308|gene|nph       MFVPARLSAALLGPAAA--DPDAPVRARRYADKPASPNAGWPMGTLAAALNVRLEKPDSY
232|gene|hla        MFLPARVTAGCLSVAAG--SIEALRWAASWAGKPGSPNSGWPMATAAAALDVRLEKPGHY
2495|gene|hut       MWLPARTTAVLIALAAR--DFGALWRARGWRGAPPSPNSGWPMATLAAVLDTRFEKPGVY
26170|gene|hbo      MWLPARLAGVLLAVSVAEFSLPFSSRVRTLARRPPSPNSGWPMATMAAVLPARLVKPGVY
2440|gene|hhi       MWLPARASALLLAVACG--SPRSVAQARDWLDGVPSPNSGWPMGTAAAALDVRLEKPGVY
1578|hp|nrc1        MWVPARLAAVLIAATAR--APAAVSRAAADAGAPPSPNSGWPMATLAAVLDCRLVKPGVY
                    *::*** :.  :. :          ..        ***:****.* ** *  *: **. *

1411|gene|hwa       ELRTSAS-----LPDKSVATYAIQITRRAGVIA-----IVLTITILEGITWL--------
5308|gene|nph       RLNELAS-----LPAAADGQRALSATRRAGIAA----YVIAALVGVVQ--WL--------
232|gene|hla        VLNPDAS-----PPSVVDAERAVRLVGVSGGVA----VALAAGWLLATR-WLPAPAGVIG
2495|gene|hut       VLNPDAT-----LPDAAAATRAIRIVAIAGTIAGAMSLLIASVQLSPGSLGLVAVGVGSC
26170|gene|hbo      DLDPASDTANTRLPTTADAMQAVRVTNRAGLLA----FALAGVIA-----WF--------
2440|gene|hhi       VLNPTRH-----LPDVATAQRSVTRVGVAGVLA----YLLAGLGVLA---WF--------
1578|hp|nrc1        ELREAAA-----LPGLAESRRGVRVVSTAGGLA----YALTAAVVYAGGGGL--------
                     *           *    .  .:  .  :*  *      :           :