HOG Organism Gene ID Name Annotation
aHOG1037 hhi 2441 cobS putative cobalamin-5-phosphate synthase
aHOG1037 hhi 4067 HAH_4067 hypothetical protein
aHOG1037 hbo HBOR26160 Hbor_26160 cobalamin-5'-phosphate synthase( EC:2.7.8.26 )
aHOG1037 hla HLAC0233 Hlac_233 cobalamin 5'-phosphate synthase
aHOG1037 hmu HMUK0143 Hmuk_0143 cobalamin 5'-phosphate synthase( EC:2.7.8.26 )
aHOG1037 hut HUTA2496 Huta_2496 cobalamin 5'-phosphate synthase
aHOG1037 hwa HQ1410 cobS cobalamin (5'-phosphate) synthase
aHOG1037 nph NP5306 cobS cobalamin (5'-phosphate) synthase
aHOG1037 nrc1 VNG1580 vng1580 no entry
MUSCLE (3.6) multiple sequence alignment


4067|hp|hhi         ------------------------------------------MKQICKVMVLTFVLLTVF
2441|gene|hhi       ----MVLTAVRGALGFLSRLPVGHSERAWDAFVGTPAAFPMAGYVVGGLVALPFLAAGLL
5306|gene|nph       MAVNDLVGGLRGGVAFLSRLPVDSGEADWERFRTLPVAFPLVGYLIGALVALPFFLP--A
1410|gene|hwa       ----MVISAIRGGIGFLTRVPIGHDKKAWDAFRQTPVAFTVIGYPLGTIVALPFVLLSIV
26160|gene|hbo      ----MVLTALRGGLVFLTRLPVGVDEASWDAFRRTPVAFPLVGYGLGALAAIPFLLP--V
233|gene|hla        ----MILTALRGALGFLTRIPVGRDEAAWAAFARSPWTFPVVGYLVGGLVALSLFVP--A
1580|hp|nrc1        ----MLAGG--------------------------------------------------V
2496|gene|hut       -----MLSALRGAVGFLTRLPVGHDEAAWEAFRSQPAAFPLVGYAIGALAALPLLAP--V
                                                                                

4067|hp|hhi         ASPAA---------------------------------AQPAQQQQ-LKDQMNQVGDFLA
2441|gene|hhi       PAPVVAAAYLGAVVLVAGVNHADGLADLGDAAVVH---GDPAERRDVMRDTTVGVGAVLA
5306|gene|nph       PSATVAFAYLLALAVVVGIPHFDGVADLGDAVAAH---G-PSSKRAALKDTDTGVGAIVA
1410|gene|hwa       PVPTLIGVYLLILIGVTGITHIDGIADIGDAAVVHDTDDEHSRRRSVLHDSQVGVGGALA
26160|gene|hbo      PVPTAAALYMAALYVLTGVTHVDGLADVGDAAAVH---GDAEERLAVLKDSQTGVGGALA
233|gene|hla        PAPTVALAFVLAVYAVTGIGHLDGVADIGDAAAVH---GDREERRRVLKDSALGVGGTVA
1580|hp|nrc1        PHGTVAFAYLAVVFAVTGINHLDGVADAGDAAVVH---GDPADRRTVLKDTTTGVGAIAA
2496|gene|hut       PSATAAVGFLAWLYVLTGINHLDGVADLGDAAVVH---GDSERRQEVLADTTVGVGAVAA
                    .  .                                       .   : *    **   *

4067|hp|hhi         IVISAVAIPNGAFGV----------------FQYMTAGTDSEQS---------DKGRKRI
2441|gene|hhi       LGTVLLALAFGALAAA--------GLPPLVAVALVLAAEVGAKLAMATLACVGRPSHEGF
5306|gene|nph       VAVVFLGLVLAALALS--------TAPLAVAVTVVIAAEVGAKLGMATVGCLGTAGHEGM
1410|gene|hwa       VTVTVVSLALGVLGAT--------RTTPQVTFILVLTAEVGAKSAMALLVCTGDAAHDGL
26160|gene|hbo      LGLALVTLGLGALSVA--------GTAPQVAFPLVVAAEVGAKTGMATLVCTGESAHEGL
233|gene|hla        LALVVLGLATAALGLVEVAATAGDGGPLPPVIGIVVAAEVGAKAATATLVCVGDAPHEGL
1580|hp|nrc1        VVVVVAGLVTGSLGVA--------ALPTWTAVGVVVATEVGAKTSMAAVACLAHAPHDGL
2496|gene|hut       VGIVFAGLATAGYTLA--------QLPARAAL-LVVAGEVGAKTAVALAACLGTATHDGL
                    :      :  .                    .  : :   . :             .. :

4067|hp|hhi         RNSFIGVA----------------------------------------------------
2441|gene|hhi       GSTVINGNSPRHLVGSL--AVALPAAVVAVPSTAVAV---L--------TGPL-LALGLS
5306|gene|nph       GSQFTTVLDSEMLVVPA--LAAVPAAVAVLPATLAAV---L--------AGPL-VAVVLV
1410|gene|hwa       GAALIDESTPLSLFPVI--LALTPLLLAIPYLGASPTAAVV--------LTPLIVALVIK
26160|gene|hbo      GSALIDVNDVSNLVPVAVSLVLLPALLITPVAGVAGVTTAAFAAVAAASFAPVAVAVLAG
233|gene|hla        GSALTGESSPGATLSVF--ALAAPAALLTWPQVLPGL-AAL--------LVALATAALVA
1580|hp|nrc1        GSQFTGNATPGALPAVA--GVALPVALASVPSPAAAG--AL--------AGAVGAGALTR
2496|gene|hut       GAQFTDRLHYRHALAPL--VVAFPAVALTWPDPSALV--AV--------AAAVTCGVGMV
                       .                                                        

4067|hp|hhi         ---------------GATAVVTAVQLLNALI-------------------------
2441|gene|hhi       GWADRRLGGVSGDTFGAANELTRAVALHISVATWSLFGGAWPVPLVDWEVLAWTLS
5306|gene|nph       DWADEQLGGVSGDIFGATNELARVAGLHLGVVAWTLW-------------------
1410|gene|hwa       QWADNALGGISGDVLGAVNEVSRAAAIHAGVVVWML--------------------
26160|gene|hbo      RWGNEHLGGVSGDVLGTANELGRVAGLHAGVLAWTLF-------------------
233|gene|hla        RWSRRRLGGVSGDVLGATTELARVAALHAGVIAWTRF-------------------
1580|hp|nrc1        RWLTGLLGGANGDVFGAVNEVSRVVGLHAGVVVWTL--------------------
2496|gene|hut       VWARRTLGGVDGDVLGATAELARVVGLHAGVIAWTLF-------------------
                                   *:.  :  .  ::  :