HOG Organism Gene ID Name Annotation
aHOG1030 hhi 2909 act2 acyl-CoA thioester hydrolase
aHOG1030 hhi 1199 act1 acyl-CoA thioester hydrolase
aHOG1030 hbo HBOR08310 Hbor_08310 acyl-CoA hydrolase
aHOG1030 hla HLAC0206 Hlac_206 thioesterase superfamily protein
aHOG1030 hmu HMUK0899 Hmuk_0899 thioesterase superfamily protein
aHOG1030 hut HUTA0827 Huta_0827 thioesterase superfamily protein
aHOG1030 hwa HQ1399 act acyl-CoA thioester hydrolase
aHOG1030 nph NP4924 act_1 acyl-CoA thioester hydrolase 1
aHOG1030 nrc1 VNG2426 act acyl-CoA thioester hydrolase
aHOG1030 hma Hma_10434 act acyl-CoA thioester hydrolase
aHOG1030 hma Hma_12480 act acyl-CoA thioester hydrolase
MUSCLE (3.6) multiple sequence alignment


4924|gene|nph       -----------------------------MVELLETFIEDRNRIQPHHANNLGTAHGGNV
827|gene|hut        -----------------------------MPTISETYLENRWRVQPNHANNYGTVHGGNV
2909|gene|hhi       -----------------------------MPTIADTHIVNRERVQPTHANNYNSAHGGIV
12480|gene|hma      -----------------------------MPTIAETHIINRERVQPTHANNYQSAHGGIV
206|gene|hla        MLSDTIDFVVDGSPFTADGPFSAGRVGTGMPTVSDTYIENRQRVQPTHTNNYESAHGGNV
1399|gene|hwa       -----------------------------MSTVTATYIENRERVQPDDVNNYGTAHGGNV
2426|gene|nrc1      -----------------------------MGSISDTFMENRERVQPDDTNNYASAHGGNV
8310|gene|hbo       -----------------------------MIDIEETYIENRILVNPNDTNNYDMAHGGNV
1199|gene|hhi       -----------------------------MPTVLETYIENRWMVQPNHSNHLGSTHGGNV
10434|gene|hma      -----------------------------MPTVLETYIENRWMVQPNHSNHLGSTHGGNV
                                                 *  :  *.: :*  ::*   *:   .*** *

4924|gene|nph       LNWMDEAGAMSAMRFAGSPCVTAHINSVDFERPLEIGEIALVEAYAYEAGRTSVRVRVRA
827|gene|hut        MKWMDELGAMSAMRAANEPCVTASIDQMNFNRPVPTGETVIIESYAYETGRTSVKVALDA
2909|gene|hhi       MKWMDEIGAMSAMRAARESCVTAQMSRVDFERPIPIGDTALIESYAYATGRTSVRVRIEV
12480|gene|hma      MKWMDEIGAMSAMRAARETCVTAQMSRVDFERPIPIGDTALIDSYAYATGRTSVRVRIEV
206|gene|hla        VKWMDEIGAMSAMRAAGETCVTAKINGLDFKRPVPQGDTCIVESYVYAVGRTSLRTRIRA
1399|gene|hwa       AKWMDEVGAMSAMRHAGNTCVTARIDRLDFERPIPQGDTCIIESYAYATGESSIRVRLRA
2426|gene|nrc1      VKWMDEIGAMAAMRHAGKTCVTARINSLDFERPVPQGDICVIQAYAYDTGHTSIKVRLRA
8310|gene|hbo       MKWMDEVGAMSAMRFAGETCVTARMESVNFHRPIPRGDAALIESYVYGAGTTSVKVRLRV
1199|gene|hhi       LKWMDELGAMSAMRFAGETCVTARMDQVNFKRPIPVGDTALIEAFVYDTGETSVKVRLRV
10434|gene|hma      LKWMDELGAMSAMRFAGETCVTARMDQVNFKRPIPVGDTALIEAFVYDTGETSVKVRLQV
                     :**** ***:*** * ..**** :. ::* **:  *:  :::::.* .* :*:.. : .

4924|gene|nph       YGEDPLNGDREVTTESYFVFVAVNEDLRPVEVPELDVETEEGKRLQEMA-----DE----
827|gene|hut        ARENPRTGEREPTTKSRFVFVAIDEDGKPVEVPDLSVGSDRCRRLRERALERERDDS---
2909|gene|hhi       AREDPHTGETEETTSAYATFVAVD-DGTPTPVPELTAESEACKRLRETALAEEPQR----
12480|gene|hma      AREEPHTGETEETTSAYATFVAVD-DGKPTPVPELTAESEECKRLRETALAEEPER----
206|gene|hla        YRESPRTGERELTTESYFVFVSVDADGTPTPVPELTVEGDRCRELRDAALAAEPDEER--
1399|gene|hwa       YRENPQTGSRERTTESYFVFVAVDEDMNPTTVADLSVESERCRKLRTEALDGERDMSQE-
2426|gene|nrc1      FREDPRSGETEPTTDSYFVFVAVDDDMQPTAVPDLDVGSERCRELREAALAGEHDE----
8310|gene|hbo       FREDPLTGETELTTESYFVYVAIDEDGDPTTVPELETNTEYGRDLLEAALEGEKENNGHG
1199|gene|hhi       ARENLRTGETESTAESYSVYVAVDEDRDPVPVPDVTAETDRGERLRQRALDGEANR----
10434|gene|hma      ARENLRTGETESTAESYSVYVAVDEDRNPVPVPDVTTETERGERLRQRALDGEANR----
                      *.  .*. * *:.:  .:*::: *  *. *.:: .  :    *   *     :     

4924|gene|nph       --
827|gene|hut        --
2909|gene|hhi       --
12480|gene|hma      --
206|gene|hla        --
1399|gene|hwa       --
2426|gene|nrc1      --
8310|gene|hbo       DD
1199|gene|hhi       --
10434|gene|hma      --