HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0103COG0704arCOG00318Phosphate uptake regulatorphosphate regulatory protein homolog

HOG Organism Gene ID Name Annotation
cHOG0103 nrc1 VNG0766 prp2 phosphate regulatory protein homolog
cHOG0103 hmu HMUK2336 Hmuk_2336 phosphate uptake regulator, PhoU
cHOG0103 hma RRNAC0819 regulatory protein
cHOG0103 hma PNG7066b prp2 phosphate regulatory protein-like
cHOG0103 hwa HQ2746A phoU transport system regulatory protein
cHOG0103 hla HLAC0693 Hlac_693 phosphate uptake regulator, PhoU
cHOG0103 hbo HBOR20600 Hbor_20600 phosphate uptake regulator
cHOG0103 hut HUTA0312 Huta_0312 phosphate uptake regulator, PhoU
cHOG0103 hvo HVO_1181 HVO_1181 prp 2-domain regulatory protein
cHOG0103 nph NP1386A phoU_5 transport system regulatory protein ( substrate phosphate)
cHOG0103 hhi 1460 HAH_1460 regulatory protein
MUSCLE (3.6) multiple sequence alignment


7066|gene|hma       MRPDRTRNREINARSSKSQEDKAVTPDPIRMKRKVQQLGSSTLAVTVPVDWARQHDISKG
312|gene|hut        --MD---------------------------TRKVQQLGPSTLAMTLPAEWTTETDVEKG
766|gene|nrc1       --MG---------------------------TRKVQQLGPSTLAMTLPAEWARSQDVVKG
693|gene|hla        --ME---------------------------TRKVQRLGPSTLAMTLPAEWAKEHGVNKG
2746|gene|hwa       --ME---------------------------TRKVQRLGPSTLAMTLPAEWAKENEVNKG
20600|gene|hbo      --ME---------------------------TRKVQRLGPSTLAMTLPAEWAKEHNVNKG
1386|gene|nph       MRME---------------------------TRKVQRLGPSTLAMTLPAEWASEQNVEKG
10819|gene|hma      --ME---------------------------TRKVQRLGPSTLAMTLPAEWASAHDVEKG
1460|gene|hhi       --ME---------------------------TRKVQRLGPSTLAMTLPAEWASAHDVEKG
                                                   .****.**.****:*:*.:*:    : **

7066|gene|hma       DEVIVQRDENGGSLLVVPEQPTIEDVEATIDADALTPDALERAIITQYVLGRQLIRVEAT
312|gene|hut        DEISI-RIGDKGTLTVLPESVQSGDTEATIYVADLDADAVERAIVAQYVLGRQVIHVEAD
766|gene|nrc1       DEVTV-REGGRGSLTVTPASARQGETEATIHATDFDADAVERAIVGQYVLGRRIIHVESE
693|gene|hla        DEVSL-RMGGKGTLTVLPESVSTEESKAVINADGLDAQSLERAIVAQYVLGRRVIHVRSE
2746|gene|hwa       DEVSL-RMGGKGTLTVLPESASQEDSSASILADNLNANALERAIVAQYVLGRRVIHIERE
20600|gene|hbo      DEVSL-RMGGKGTLTVLPESASQEDALATIRADALNADALERAIVAQYVLGRRVIHIEKS
1386|gene|nph       DEVSL-RMGSKGTLTVMPESVQQEESEAVIHAQSLDADAVERAIVAQYVLGRRIIHVEVE
10819|gene|hma      DEVSL-RMGGKGTLTVMPESVQTEESEAIIHAENLDAASVERAIVAQYVLGRRVIHVEAP
1460|gene|hhi       DEVSL-RMGGKGTLTVMPESVQTEESEAIIHAENLDAASVERAIVAQYVLGRRVIHVEAP
                    **: : *  . *:* * * .    :  * * .  : . ::****: ******.:*.:   

7066|gene|hma       A--PLGIEHRDAIMNAERRLMGLGIVEQAERTVTVRCSVAPEDFDLPTLLGRLSRTEAVI
312|gene|hut        EGATLDSAHINAVYNAETQLMGLGVIEETPERITVRCSVDPGDFSLHNLLERLESTGSTM
766|gene|nrc1       A--ALDSAHINAVYSAETQLMGLGVVEETPARITIRCSVDPADFDLNNLLERLENTGSTM
693|gene|hla        G--TLDSEHINAVYKAETQLMGLGVIEETPSDISIRCSVDPEDFTLDNLLERLENTGSTM
2746|gene|hwa       DA-ALDSEHINAVYSAETQLMGLGVIEETPERIAIRCSVDPEDFTLDNLLERLENTGSTM
20600|gene|hbo      EG-ALDSEHINAVYKAETQLMGLGVIEETPERIAIRCSVDPEDFSLDNLLERLENTGSTM
1386|gene|nph       EGGTLDSAQINAVYNAETQLMGLGVIEETPERIAIRCSVDPEDFTLDNLLERLESTGSTM
10819|gene|hma      EGETLESSHINAVYNAETQLMGLGVIEETPDRIAIRCSVDPEDFTLNNLLERLESTGSTM
1460|gene|hhi       EGETLESSHINAVYNAETQLMGLGVIEETPDRIAIRCSVDPEDFTLNNLLERLESTGSTM
                       .*   : :*: .** .*****::*::   :::**** * ** * .** **. * :.:

7066|gene|hma       RGDAISALIEGDTDLVETVESRQEQVEKLFYLFLRLVFTIYRNPRLNQAVGLETGFPLIG
312|gene|hut        RNEAIRALAHGNPDLAQRALNRERQANKIFVLLLRLIFTAHQNPNVARGIGLDDAFPLIG
766|gene|nrc1       RGEAVKALAHGNPDLAQRALNRERQANKIFVLLLRLIFTAYHDPGLARTVGLDEGFPLVG
693|gene|hla        RGEAVKALAHGNPDLAQRALNRERQANKIFVLLLRLIFTAYQNPNLARAVGLEEGFPLIG
2746|gene|hwa       RGEGIKALAHGNADLAQRALNRERQANKIFVLLLRLIFTAYQNPNLARAVDLNSGFPLIG
20600|gene|hbo      RGEAIKALAHGNPDLAQRALNRERQANKIFVLLLRLIFTAYQNPNLCRAVGLESGFPLIG
1386|gene|nph       RNEGVKALAHGNPDLAQRALNRERQANKIFVLLLRLIFTAYQNPNLARAVGLSSGFPLIG
10819|gene|hma      RNEAVKSLAHGNPDLAQRALNRERQANKIFVLLLRLIFTAYQNPNLARAIGLNDGFPLIG
1460|gene|hhi       RNEAVKSLAHGNPDLAQRALNRERQANKIFVLLLRLIFTAYQNPNLARAIGLNDGFPLIG
                    *.:.: :*  *:.**.: . .*: *.:*:* *:***:** :.:* : . :.*. .***:*

7066|gene|hma       YRSVAQDVVLMADTAVEIASLATDSATP----DQLTASKLTELGDALDDAASATRSAVTT
312|gene|hut        YRSVAKNLELAADNAEDIADIALEADGHSLDVDAGTMDRIRDMVEQVDKISEQAVKAAVD
766|gene|nrc1       YRSVAKNLELVADNAEDIAEIVMATDGHTLDVDQATMRRIREFTDAVDDVAASAVSAAVN
693|gene|hla        YRSVAKNLELTADNAEDIADIVMEAEGHTLDVDSATMRQIREFTDQVDDLTALAVQAVVE
2746|gene|hwa       YRSVAKNLELIADNAEDIATIVGDADEHTLDVDTGTMRRIREFTDQVDEITQIAVNAVVE
20600|gene|hbo      YRSVAKNLELTADNAEDIANIVMDADGHTLDIDSTTMRRIREFTDQVDKITATAVQSVVE
1386|gene|nph       YRSIAKNLELTADNAEDIAEIVLETEGHTLNVDQKTMRRIREFTDDVNEITELGVQAAVT
10819|gene|hma      YRSIAKNLELTADNAEDIAEIALETEDHSLNVDSSTMRRIREFTDQVNDITELAVQAAVD
1460|gene|hhi       YRSIAKNLELTADNAEDIAEIALETDDHSLNVDSSTMRRIREFTDQVNDITELAVQAAVD
                    ***:*::: * **.* :** :.  :       *  *  .: :: : ::. :    .:.. 

7066|gene|hma       PDYDATEDARAAFDLVDDRIADLNAHLE-SERPEPLLALQRAVVLLERSARHARDSLSVA
312|gene|hut        RDYPAAIEVRSKFREIDEMGADLLDGLE-EMPNEKLLAVREVLVGLQDTAQYSVRNAEIA
766|gene|nrc1       RDYDATVAVREQFSAIEDREADILADLP-EMNNADLLEAREVLVSLQQSAQYSMRNAEIA
693|gene|hla        RDYDLTVECRDLFGRLEDREQEILGELPNDLDNDTLLMTREVLVSLQHTAEYAMRNAEIA
2746|gene|hwa       RNYDKTITARTLFQQISDREDEILSDLP-EMDNDNLLQIREVLVSLQQTAQYAMRNAEIA
20600|gene|hbo      RDYDLTVECRELFRDIRDKERDILDDLD-EMDNQKLLQIREVLVSLQQTAQYAMRNAEIA
1386|gene|nph       RDYDLAIETRDAFADIRNREVEILDDLD-EMPNEDLLRVREVLVSLGQTAQYAVRNAEIA
10819|gene|hma      RNYDTAIQVRELYKDIGDKEHEILDDLP-EMDNEALLEVREVLVSLQQTAEFAVRSAEIA
1460|gene|hhi       RNYDTAIQVRELYKDIGDKEHEILDDLP-EMDNEALLEVREVLVSLQQTAEFAVRSAEIA
                     :*  :   *  :  : :   ::   *  .     **  . .:* *  :* .:  . .:*

7066|gene|hma       THLAFRNDPSLVTGE
312|gene|hut        TNLALNEESEHITLE
766|gene|nrc1       ANLALNEQSAHTTLT
693|gene|hla        ANLALNEPSDHVEII
2746|gene|hwa       ANLALNEECEHVKIR
20600|gene|hbo      ANLALNEESDHVTIG
1386|gene|nph       TNLALNEESDHVTIK
10819|gene|hma      TNLALNEESEHTTIE
1460|gene|hhi       TNLALNEESEHTTIE
                    ::**:.: