HOG Organism Gene ID Name Annotation
aHOG1029 hhi 2349 argA2 acetyltransferase
aHOG1029 hbo HBOR23230 Hbor_23230 acetyltransferase
aHOG1029 hla HLAC0790 Hlac_790 GCN5-related N-acetyltransferase
aHOG1029 hla HLAC1136 Hlac_1136 GCN5-related N-acetyltransferase
aHOG1029 hmu HMUK3082 Hmuk_3082 GCN5-related N-acetyltransferase
aHOG1029 hut HUTA0345 Huta_0345 GCN5-related N-acetyltransferase
aHOG1029 hwa HQ1620 protein N-acetyltransferase-like protein
aHOG1029 nph NP1638 protein N-acetyltransferase-like protein
aHOG1029 nrc1 VNG0654 act3 Hpa2-like histone acetyltransferase
aHOG1029 hma Hma_11824 acetyltransferase
MUSCLE (3.6) multiple sequence alignment


1136|gene|hla       MTVRPAESDDREQIRAIARDSLQSSY--SLSPDQIEMILEEEFDDTALTDLLDDSDTTVL
1638|gene|nph       MEIREATADDGPAVRSVTLRSMEASY--SLSPSTIESAIQQWYGVDNFAEKLNDD-EVLL
345|gene|hut        MNIRTATPADTPAIRDVARRSLQASY--ALSPQTITTGIEEWYGEAQLEESLDSD-DRIL
2349|gene|hhi       MKIREAVPSDRPAIRDVARRSLEASY--SLGPKAITSAIEEWYDEARIEEVLDDDSNRLI
11824|gene|hma      MEIREAVLSDRPAIRDVARRSLEASY--SLGPKAITSAIEEWYDEARINEILSEESNRLL
654|chp|nrc1        MIVREATHADGDAVRAVANASLEASYADPLGDDIVHTAATEWYDSDRLADRLDTD-AVQY
790|gene|hla        MELRPATLDDIDAIRTVARESLIASYGHAVDETLLAEAVDEWYDPDELGADIGDD-DTVF
1620|gene|hwa       MDIRDATIEDIEEIRDVARESLAASYGHAIDDKVIDAAIEEWYSKDALKETLTTD-DAVF
23230|gene|hbo      MDLRDATTSDIRQIRTVANESMKASYRHAIDEETIEEAVEGWYGDDTLSEWLTDD-AVEF
                    * :* *   *   :* ::  *: :**  .:.   :       :.   :   :  .     

1136|gene|hla       VVEETVDDTETVRGFITVEIGTE-------------ATIRWLHVDPTARGGGIATALLER
1638|gene|nph       LVAE---KDGEPVAFSESALVDDR------------GDIHWIHVAAMHRGEGIGQAMYEE
345|gene|hut        LVAD---VDEQVVAFSESTLTAGRPWVVDESDHGRDAMLLWLHVDPDYRGEGIASTLFDE
2349|gene|hhi       LVGE---QDGQVVGLSESVLSGDSI-----------GTILWLHVDPAYRGEGIGSALFDE
11824|gene|hma      LVGE---QDGQVVGLSESVLSGDSI-----------GTILWLHVDPAYRGEGVGSALFDE
654|chp|nrc1        LVAE---RDDAVVGFSESERDGDV------------AAIQWLHVHPDARGDGVGGSLLSD
790|gene|hla        PVAV---VDDTVVGFAESYVVGRRERV---------GEIDWLHVHPDHRESGIGSSLLER
1620|gene|hwa       VLAV---DDGGPIGFAQSELITGREAI---------GYIDWLHVGPDHRGVGIGSQLLSR
23230|gene|hbo      IVAV---DDGDVVGFVQSYVSEGRETV---------GEIDWLHVIPDHRGEGIGSQLLKR
                     :           .:                     . : *:** .  *  *:.  : . 

1136|gene|hla       VREQYADK---PIAACILDEAVEGGEFLEGFGLKQGDHDHLLVGGEEFAVTMF---TEGQ
1638|gene|nph       TRSQLEDAGAETIRGLVLSMNTEGNRFWENRGLQKAGEGTVEIDGTAFVENIY---VD--
345|gene|hut        TIGRLRDEGAMAIQGRVLANNQDGTGFFESKGFERVGRTEIEIGGRNQIEYRY---I---
2349|gene|hhi       THGELHDRGAETLQGRVLADNVEGNSFYEDRGFERAGTGEVDIAGRTYVENLY---TD--
11824|gene|hma      THGELHDCGAETLQGRVLADNVEGNSFYEDRGFERAGTGEVDIAGRTYVENLY---TD--
654|chp|nrc1        TETHLLEHGASRIEGRVLAANEPGNDFYQAHGYARSGTRELAIRDDTHTEHLY---VKLP
790|gene|hla        VESELRAADVDRMVARVLVDNEAGTAFYDREGYDLDGERSVEIGDETFDEREY---RKQI
1620|gene|hwa       LRQALMNAGADRLEGRVLTENETGLGFYKDQGFSVAGKRTVTIRDETFTERVYSLFVDST
23230|gene|hbo      AEQELTTRGVDRIEGSVLADNEAGADFYAEQGFERTDDRRIEIGEESFEEQTY---TQRL
                                : . :*     *  *    *    .   : :         :       

1136|gene|hla       STETPTEPTVTVPESVTVDGVDLSIDRDDSVPGSEAPFFTVYSADGEEEVYGYFCSQCGS
1638|gene|nph       EDAVELQPVV-------VDGQELYIDRNDSSRGSSGPFYTVYTDEEGENHHSYYCGSCES
345|gene|hut        AEQTGLEPLE-------SGGETVYVDHDESERGSTAQFHIVYADDDRQDRYGYYCDNCGE
2349|gene|hhi       ADELGREPVT-------DDGRTVYVDHNNHESGSMAPFHVVHVTEEGSDRYGYYCSNCET
11824|gene|hma      ADELGRERIT-------DDGRTVYVDHNNHESGSMAPFHVVHVTEEGSDRYGYYCSNCET
654|chp|nrc1        AAASTAAMTE---RRETTVG-DLWVALDERERGSDAPFYAAYRDADRETKYGFYCAACEH
790|gene|hla        GRLTGISEGT---YKT-EDGETVYVAFDESDRGSRAPFYVAYADDDLTQRYGYLCGNCEG
1620|gene|hwa       EEPAANKQQT-------EAGETVYIAYDETVRGSEAPFFAAYFDEDHEDRYGWFCGADES
23230|gene|hbo      DDEGERIITE---ERTLDDGRTVYIAYDDAVRGSKAPFYAVYMNPEENERYGWMCGEDQS
                                       *  : :  ::   ** . *. .:        :.: *     

1136|gene|hla       TDVSIDGLDRLECGDCGNTHLADEWDDAYL
1638|gene|nph       LVTSMDTMGRLSCEECGNQLKPTRWDAAYM
345|gene|hut        LANAMDAMGRIECNSCGNRRKPTRWDAAYL
2349|gene|hhi       LANAMDSMGRIECDNCGNVRKPMRWDAAYL
11824|gene|hma      LANAMDSMGRIECSSCGNVRKPMRWDAAYL
654|chp|nrc1        ADTAMNTMGRVACNNCGNERRETRWDAAYL
790|gene|hla        TNIAIDTMDRMECRDCGNRRKPARWDAAY-
1620|gene|hwa       LDVAMDTMERIECTACGNQRRPVRWDAAYL
23230|gene|hbo      FDIAMDTMDRIECNSCGNKRKAARWDAAYL
                       ::: : *: *  ***      ** **