HOG Organism Gene ID Name Annotation
aHOG1025 hhi 1203 exoM succinoglycan biosynthesis/family 2 glycosyl transferase protein
aHOG1025 hhi 5334 HAH_5334 hypothetical protein
aHOG1025 hhi 5172 HAH_5172 hypothetical protein
aHOG1025 hla HLAC1063 Hlac_1063 glycosyl transferase family 2
aHOG1025 hmu HMUK2753 Hmuk_2753 glycosyl transferase family 2
aHOG1025 hut HUTA0540 Huta_0540 glycosyl transferase family 2
aHOG1025 hwa HQ2692 glycosyltransferase
aHOG1025 nph NP1916 gtl_2 glycosyltransferase 2
aHOG1025 nrc1 VNG1067 exoM succinoglycan biosynthesis protein
aHOG1025 hma Hma_10430 exoM succinoglycan biosynthesis protein
MUSCLE (3.6) multiple sequence alignment


1067|gene|nrc1      MPQSTILIQAPVTFPMMKVSVVVCTYSMDRYGPFADAVESVLAQTHDDLEVVLVVDGNDD
1916|gene|nph       ----------------MDVSVVVCVYSMDRFESFVEAVESVLAQTYDPIEAILVVDGNQA
540|gene|hut        ----------------MRVSVVICLHTLDRYDDFTEAVESVRAQTYDDVELVLVSDGSDG
1203|gene|hhi       ---------------------------MERYDDCRAAAESVLAQTYDDVELVLVSDGNQE
10430|gene|hma      ---METPNSTGGTPPTMRVSVVLCTHTMERYDDCRAAAESVLAQTYDDVELVLVSDGNRD
1063|gene|hla       ----------------MKVSVVVCTYTLDMYEHFREAADSVLAQTHDDVELVVVVDGTPE
2692|gene|hwa       ----------------MKVSVVICTYTLNMYEHFCEAADSVLAQTYDDVEIVVIVDGTPD
5334|hp|hhi         -----------------MVSVSVVIATLKPRDEI-EAIQCLKEHAFDDFEVIVCDESP--
5172|hp|hhi         -----------------MPELSIIIPTLDPNIEF--SWEEKLVDAAVEGEILVCTEGS--
                                               :.       : :     :    * ::  :.   

1067|gene|nrc1      VFERVRADFGDEEHVVLHCNDENQGISYSRTKGAKIASGDIVAFIDDDATAEDDWIEQLL
1916|gene|nph       VYERVADRFGDRDDVVVHCNEENRGVSVSRTHGAELASGDVVAFIDDDAVAEPDWIEHLV
540|gene|hut        VFEQFRTDFGEDDDATLVKLAENRGLLEARNAGAEAASGEVVAFLDDDAIAAPDWIDRLV
1203|gene|hhi       VYEQYDSDYGDRDAVMTHCNDANVGLLESRNNGAGVATGDVVAFIDDDAIADEEWVAALV
10430|gene|hma      VYKQYQSDFGNRDDVLTHCNDANVGLLESRNNGAEVATGDVVAFIDDDAIADEEWVAALV
1063|gene|hla       VYEQVVDDYGDREDVVIECNDENVGLLESRNRGAAIASGDVVAFIDDDAIADEAWVERLV
2692|gene|hwa       VYERVIDDYGDREDTVIKCNDENLGLLQSRNQGAEIASGDVVAFIDDDAIADEVWVERLV
5334|hp|hhi         -------------------------VTRARNEGIKQASTDKIVFLDDDSRPRPEYLQKAD
5172|hp|hhi         -------------------------AAAARNKGIREANGEKLVFLDDDSVPKGEYFDRVS
                                                :*. *   *. : :.*:***: .   :.    

1067|gene|nrc1      GVYAETDAIAVGGDVVPDWQTQKPDFFPAEFYWLVGCVEPGFA-----DDGEEVRNTYGS
1916|gene|nph       EAYEKHDAVAVGGRMTGEWLAGRPSFLPDEFDWLVGVTHRGFA-----DGRTEVRNTFES
540|gene|hut        EAYEERDSLAVGGKMTPEWVAGKPDFLPAEFYWLVGVTHRGFGPGGDMDAAGEVRNTFGS
1203|gene|hhi       DAYERHDALAVGGRMTPAWVAGKPSFLPEEFYWLIGVTHRGFGPNGDPDEPGVVRNTFGS
10430|gene|hma      DAYEQQDALAVGGRMTPAWVAGKPSFLPAEFYWLIGVTHRGFGPNGDPDEPGVVRNTFGS
1063|gene|hla       RAYEEEDAIAAGGKMTPAWVAGKPSFLPEEFYWLIGVTHRGFA-----DGPGEVRNTFGS
2692|gene|hwa       RAYEERDTVAVGGKMVPEWVAGKPSFLPEEFYWLVGVTHRGFA-----DGSGEVRNTFGS
5334|hp|hhi         ELLETEAAYA--GRTIHPVDDVFARHFTTHYDW---------G-----DDPCYVNHFWGC
5172|hp|hhi         ELLDEYPAVT--GRI-HDTGSPYTRGLSGQYDQ---------G-----DNGHVTDTVVGC
                           : :  *          .  :.  : .         .     *    .     .

1067|gene|nrc1      NISYRRDQFLDVGGYDPNTG-RKGDKHLQAHEAPVGIRLREEYGRGMVFTRDARVHHKLF
1916|gene|nph       NISFRREVFLDLGGFDPELG-PTGEEYRHSEGAEIGARLEAEYDRGVMYIPEAIVRHKVF
540|gene|hut        NISFRRDVFLELDGFDTKIGGRQGDANLQGGETELCARLRESYGEGVWYVPDAEVDHKVF
1203|gene|hhi       NISFDRDVFLELGGFDDDIGGRQGEKNLQGGETELCARLRTEYDEGVYYTPDALVAHKIF
10430|gene|hma      NISFDRDVFLELGGFDDDIGGRQGEKNLQGGETELCARLRTEYDEGVYYTPEALVAHKIF
1063|gene|hla       NISFRADVFEVLGGFDVDIGGRKGDKNLQGGETELCARMREEYGGGVWYDPEAEVAHKVF
2692|gene|hwa       NISFRTSVFEELGGFDANIGGRKGDKNLQGGETELCARMQQEYGHAVWYDPEAEVAHKVF
5334|hp|hhi         NMGVHRDVFKAVGGWDEQMG-------WGHEEKELARRVRAEFD--IRYDPELIVDHPYA
5172|hp|hhi         NMAIRRDVLEDVGGFDERLP-------YGHEEVELIDRVFESYT--VWYSPDLLVEHPFA
                    *:.   . :  :.*:*                  :  *:  .:   : :  :  * *   

1067|gene|nrc1      DYRGEFGWLVSRSFWQGYSKRVMDLLYPDAEDNKSSYLTQLLTRFVPTRARNLVQSPSV-
1916|gene|nph       EHRTRLSWLCRRAFEQGVSKRAMKRRTDGSSAEEFGFLRSLFLEHLPRRLRELIDEPSV-
540|gene|hut        AYRTGLWWLLDRAFWQGYSKRAMEVLVEDDGGEEGDFLGLLLGRFVPARVSQLIRRPSV-
1203|gene|hhi       DYRTDPGWLVDRAFWQGYSKRGMEVFVPESTGEESDFLSDLLFRFLPLRLRGLVESPSL-
10430|gene|hma      DYRTDPGWLLDRAFWQGYSKRGMEVFVPESTGEESDFLSDLLFRFAPERIWGLVRAPSV-
1063|gene|hla       EYRTEFRWLVDRAFWQGYSKRAMESFVEDEGGEEGAFLKYILTNTTPRRVKRLVSREPL-
2692|gene|hwa       DYRTKLCWLIDRAFWQGYSKRAMESFVDNEGNEEKEFLRELMTSVVPIRIRSMISNPST-
5334|hp|hhi         SSITEYW---KKQYKL---ETKSPYYWSKCNVSRADQLKNIFCEALDP--LNYVRITPV-
5172|hp|hhi         ESIPDY---LEKQYRHG--KESIPYY-------------KIRGENVPRRIMRFILIPTYY
                               . :     :                    :            :   .  

1067|gene|nrc1      --QRLQQLVAIFVFTAAVGLGYVYAIATPNLVAHANS-------------------
1916|gene|nph       --AGVAQIVMLFVFTGLVGVGYLFE-SAWGIVSR----------------------
540|gene|hut        --QRVTQLLTLALFTGVVGAGYLYGYTRY---------------------------
1203|gene|hhi       --GAVLQLVFLFLLTSSVGVGYLYGMYVWR--------------------------
10430|gene|hma      --AGVLQFVFLFALTAFVGFGYLYGMTVWG--------------------------
1063|gene|hla       --TEIKLFVMVYLLTGLVGFGYLYGTLTYSA-------------------------
2692|gene|hwa       --NGMSQFFGLFLFTFIVGIGYTYALWDWDDDTLIQRSGDLSGSPGSSSNTHSEKT
5334|hp|hhi         --ATVIEAGSTVAKTA----GRIRGFLNHTHYEEDRGEVPNIDRPSESAGPSD---
5172|hp|hhi         LDSTVSKSIISTVGQVVSNIGMLHGYLTYELASSDHLTTAETD-------------
                        :               *