HOG Organism Gene ID Name Annotation
aHOG1022 hhi 970 camH3 creatinine amidohydrolase
aHOG1022 hbo HBOR19960 Hbor_19960 uncharacterized protein, putative amidase( EC:3.5.2.10 )
aHOG1022 hla HLAC1389 Hlac_1389 Creatininase
aHOG1022 hut HUTA0548 Huta_0548 Creatininase
aHOG1022 hwa HQ1805 cre creatinine amidohydrolase
aHOG1022 nph NP2120 hypothetical protein
aHOG1022 nrc1 VNG1769 vng1769 no entry
aHOG1022 hma Hma_10223 camH3 creatinine amidohydrolase
MUSCLE (3.6) multiple sequence alignment


2120|hp|nph         -----------------MYLGDVSWPEAGTHLDATDVALVPVGSTEQHGPHLPLSTDHVI
548|gene|hut        -----------------MYLADAAWPDLSSYFESESIALIPLGSTEQHGPHLPEGTDHLI
1389|gene|hla       -----------------MYLADHTWPELGEALSDESVALVPLGSTEQHGPHLPLATDHLI
19960|hp|hbo        -----------------MYVADRTWPELGDYVAAESLAVVPLGSTEQHGPHLPLATDHLI
1805|gene|hwa       -----------------MRVAEQTWPELDSYISEESLAVVPLGSTEQHGPHLPLSTDHLI
1769|chp|nrc1       LIAGSAGYLLPASPEQRVYLADEAWPELGDYFDAESLALVPLGSTEQHGPHLPESTDHRI
970|gene|hhi        -----------------MYLADETWPDLGDYFETESLALVPLGSTEQHGPHLPLATDHLI
10223|gene|hma      -----------------MYLADETWPDLDDYFETESLALVPLGSTEQHGPHLPLATDHLI
                                     : :.: :**: .  .   .:*::*:*********** .*** *

2120|hp|nph         AEGLAREAADRAGVVCTPTITVGVSPHHRQFHGTMSVEAPVFRDYVESLSRSLVYQGIDR
548|gene|hut        AEAFATEAADRTGFLRTPPVRIGVSPHHQQFPGTMSVDPPAFRDYVESFTRSLTNHGIDR
1389|gene|hla       AEALASAAAEETGAVRTPTVTVGVSPHHRQFPGTMWVDPPEFRDYVEGFTRNLAYHGIDR
19960|hp|hbo        AEALAREAADRTDVLCTPTVNVGVSPHHRQFHGTMWVDAPQFRDYVESMTRNLAYHGIDR
1805|gene|hwa       AEAFAREATDRTGYLCTPPINIGVSPHHRQFHGTMWVDAPVFRDYVESLTRNLAYHGIDR
1769|chp|nrc1       AEAFARTVADRTGVLCTPPVNVGVSPHHRQFPGTMWVEPPVFRDYVASFTRNLAFHGIDR
970|gene|hhi        GEAFAREAADRTGYLCTPTINVGVSPHHRQFNGTMWVDAPVFRDYVESFTRNLAYHGIDR
10223|gene|hma      GEAFAREAADRTGYLCTPTINVGVSPHHRQFNGTMWVDAPVFRDYVESFTRNLAYHGIDR
                    .*.:*  .:: :. : **.: :******.** *** *:.* ***** .::*.*. :****

2120|hp|nph         IVYVNAHGGNVEHLREVGRRLHEDGAAYAVEWMWDESIPDLVDDLFEQNGPHAGPKETSM
548|gene|hut        VIYVNAHGGNITHLREVGRRLREDGTVFAVEWMWDESIPEQVNDVFDHNGPHGGPKETAL
1389|gene|hla       VVFVNAHGGNVQHLREVGRRLHEDETAYAIEWMWDESIPELVDDLFEHNGPHAGPKETAM
19960|hp|hbo        VVYVNAHGGNAQHLREVGRRLRDDGTMYAIEWMWDESIPDLVNEVFEHNGPHGGPKETAM
1805|gene|hwa       VIYVNAHGGNVEHLREVGRRLRDDETLYAIEWMWNESIPELVDTLFEQNGPHGGPKETAM
1769|chp|nrc1       VVFVNAHGGNVSHLREVGRRLRDEGTLYAVEWMWDESIPELVDEVFDQNGPHGGPKETAL
970|gene|hhi        VIYVNAHGGNVEHLREVGRRLRDDEVLYAIEWMWDESIPDLVDDLFEQNGPHGGPKETAM
10223|gene|hma      VIYVNAHGGNIEHLREVGRRLRDDEVLYAIEWMWDESIPDLVDDLFEQNGPHGGPKETAM
                    :::*******  *********.:: . :*:****:****: *: :*::****.*****::

2120|hp|nph         VWYL-ADNVREDELADARDGGCPALEDIRT-TYNGARLFYDAIENSDNGAFGDPTDATAA
548|gene|hut        IQHLHPDLVHEGRLEDARDGGRVEVSQDVG-RVHGARTFYDSIENSENGVFGDQTEATAE
1389|gene|hla       ITHIAPELVKTDRLEDARDDGLVHLDESDA-VVHGARTYYDAVDNSANGAFGDPTDVTPE
19960|hp|hbo        IMHIAPELVREDRLEDARDGGLVDLDDSDRYMKHGARTFYDAIENSENGVFGDQTDATPE
1805|gene|hwa       IQYLQPELVSTDRLADARDEGLIEFTDDNT-RRFGSRTFYDAIDNTNNGVLGDQTDATPE
1769|chp|nrc1       MQYLDGEHVHDDRLEDARDGGVASVADADT-IKHGSRTFYDAIDNTDNGVLGDQTDATAE
970|gene|hhi        IQHLRAELVHDDRLEDARDGGIPSVEAAET-KKYGSRTFYDAADNTGNGVLGDQTDATAE
10223|gene|hma      IQHLRSELVHDDRLEDARDGGIPSVEAAET-NKYGSRTFYDAADNTDNGVLGDQTDATAE
                    : ::  : *  . * **** *   .         *:* :**: :*: **.:** *:.*. 

2120|hp|nph         KGERLFEAASEQLADLAEWLAAQPWETLAPREHVRSRDESKR
548|gene|hut        IGAELFDAASDELVALAEWLDEQPFEDLMPREHVSTRS----
1389|gene|hla       KAERLFEAASDQLVQLVEWLDARDRAELLPKDRVE-------
19960|hp|hbo        TGERLFEAATEQLVHLIEWLNDRRFEDLMEPAHVDPQPGSRR
1805|gene|hwa       KGEKMFESATEQLVKLCRWLDRQTIADLMPKDHV--------
1769|chp|nrc1       TGERLFEAASDQLVQLCEWLDAQAFADLLPEPHVST------
970|gene|hhi        KGAEMFEAATEQLVRLCEWLDGQAFDDLLPEPHV--------
10223|gene|hma      KGAEMFEAATEQLVRLCEWLDAQAFDDLLPEPHV--------
                     .  :*::*:::*. *  **  .    *    .*