HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0102COG0704arCOG00318Phosphate uptake regulatorphosphate regulatory protein homolog

HOG Organism Gene ID Name Annotation
cHOG0102 nrc1 VNG0458 prp1 phosphate regulatory protein homolog
cHOG0102 hmu HMUK1794 Hmuk_1794 phosphate uptake regulator, PhoU
cHOG0102 hma RRNAC1510 prp3 phosphate regulatory protein-like
cHOG0102 hma RRNAC2150 prp1 phosphate regulatory protein-like
cHOG0102 hwa HQ3308A phoU ABC transport system regulatory protein
cHOG0102 hla HLAC1545 Hlac_1545 phosphate uptake regulator, PhoU
cHOG0102 hbo HBOR08050 Hbor_08050 phosphate uptake regulator
cHOG0102 hut HUTA0914 Huta_0914 phosphate uptake regulator, PhoU
cHOG0102 hvo HVO_2374 HVO_2374 prp phosphate regulatory protein-like
cHOG0102 nph NP1976A abc14r_1 ABC transporter
cHOG0102 hhi 2632 HAH_2632 phosphate regulatory protein-like protein
cHOG0102 hhi 2080 HAH_2080 phosphate regulatory protein-like protein
MUSCLE (3.6) multiple sequence alignment


458|gene|nrc1       -MERRKVQVTGGSTFTVSIPKDWARDHSVEAGDEVGFHPDSGSLLLTPIDDTDTDKGTLT
1545|gene|hla       -METRKVQVTGGSTYTVSIPKTWATENDVEAGTEIEFHPDGDSLFLTPRSEEERTRGTID
3308|gene|hwa       MVETRKVQVTGGSTFTVSIPKEWANSNDISAGSVVEFYPEGDSLLLAPTTDEERTRGSLD
8050|gene|hbo       MVETRKVQVTGGSTYTVSIPKDWATENSVSAGSEVEFYPEGDSLFLTPRTEDERTEGTLD
1976|gene|nph       -METRKVQVTGGSTYTVSLPKGWATENDISGGSVVEFHPEEESLLLTPRHGDDKIEGTLD
914|gene|hut        -METRKVQVTGGSTYTVSLPKEWATENDVSAGSVVEFHSEEDMLLLSPQDDRERAEGSLD
12150|gene|hma      -METRKVQVTGGSTYTVSLPKEWATENDVSAGSVVEFHAERDLLLLAPQRDNGRVEGSLD
2632|gene|hhi       -METRKVQVTGGSTYTVSLPKEWATENDVSAGSVVEFHAERDLLLLAPQRDNGRVEGTLD
11510|gene|hma      -METRKVQLTGGSTYTVSLPKEWATENGVESGSVVEFYAEDDLLLVSPQHGDDHVEGTLD
2080|gene|hhi       -METRKVQLTGGSTYTVSLPKEWATENGVESGSIVEFYAEDDLLLVSPQHGDDHVEGTLD
                     :* ****:*****:***:** ** .:.:..*  : *:.:   *:::*        *:: 

458|gene|nrc1       ITDMHGE-ELMRAVMTMYVSGFDVLALEAESIDPDQRRVIRDATQGLVGLEVLEETSQRV
1545|gene|hla       ITDLSGQ-ALTRAVTTMYVSGFDVIELEGTEITTEQRSTVREAVQGLVGLEVLEETRNRV
3308|gene|hwa       VTDLAGE-ELTRAVMTMYVSGFDIISLTSSRITTTQRRTIREATQSLVGLEVLEETRDRI
8050|gene|hbo       IANLAGD-ELTRAVMTMYVSGFDIIALESGRITTEQRRTIREATQSLVGLEVLEETRDRV
1976|gene|nph       ITGLEGD-ELMRAVVTMYVSGFDIITLETAQVSAAQRRTIRDATQGLVGLEVIGETSGRV
914|gene|hut        VSGLTEETELTRAVMTMYVSGFDIIRLEAPRISATQRRYIRNATQGLVGLEVIEETGDRV
12150|gene|hma      VEGLENRHELTRAVMTMYVSGFDIIQLEATRITAEQRRIIRDATQGLVGLEMIEETTDRV
2632|gene|hhi       VEGLENRHELTRAVMTMYVSGFDIIQLEATRITAEQRRIIRDATQGLVGLEMIEETTDRV
11510|gene|hma      VTGLENRHELTRAVMTMYVSGFDIIRLEAARITAEQRRIIRDATQGLVGLEMIEETADRV
2080|gene|hhi       VTGLENRHELTRAVMTMYVSGFDIIRLEAARITAEQRRIIRDATQGLVGLEMIEETADRV
                    : .:     * *** ********:: *    : . **  :*:*.*.*****:: **  *:

458|gene|nrc1       VIQDLLDSSELSIHNAVRRMHLIAVSMLEDAVTALATRDPDIARDVTNRDDDVDRLWYVV
1545|gene|hla       VVQDLLDSSELSIHNAVTRMRLISLSMLEDAIAALSERDHDLARDVIGRDDDLDRLWLVV
3308|gene|hwa       VVRDLLDSSELSIHNAVTRMRLIALSMLGDAIDAIATLDTDMARDIIQRDDDVDRLWMVV
8050|gene|hbo       VIRDLLDSSELSIHNAVTRMRLISLSMLEDAIAAIAELDDDMARDVIQRDDDVDRLWMVV
1976|gene|nph       RLQDLLDSSELSMHNAVTRMRLVATTMLADAVTALLDDDDELAADVVQRDDDVDRLWSMV
914|gene|hut        VLQDLLDSSELSVNNAITRMRLVSLTMTADAVTALIEDDDELAADVMERDDDVDRLWYMV
12150|gene|hma      VLQDLLDSSELSVHNAITRMRLVSLTMLSDAVEALIEDDDDLAADVMQRDDDVDRLWYMV
2632|gene|hhi       VLQDLLDSSELSVHNAITRMRLVSLTMLSDAVEALIEDDDDLAADVMQRDDDVDRLWYMV
11510|gene|hma      VLQDLLDSSELSVLNAITRMRLVSLTMLSDAVEALIEDDNDLAADVIQRDDDVDRLWYMV
2080|gene|hhi       VLQDLLDSSELSVLNAITRMRLVSLTMLSDAVKALIEDDNDLAEDVIQRDDDVDRLWYMV
                     :.*********: **: **.*:: :*  **: *:   * ::* *:  ****:**** :*

458|gene|nrc1       SRIFRGALRSPTVAQEIGITREVAFDYHSSARQLERVADHATKIATATHDLNDDIPEDVV
1545|gene|hla       SRIFRATLRTPKAAEELGLPREECFDYHSSARQLERIGDHATKIAHLTLNIDEPLPDDVV
3308|gene|hwa       SRIFRSTLRTPKAAEELGLEREMCFDYQSAARQLERIADHATKIGHLTLKFNEQVPEDVI
8050|gene|hbo       SRIFRATLRTPKAAEELGLPREVCFDYQSAARQLERIGDHATKIAHLTLNFEEPVSEDVV
1976|gene|nph       SRVFRSVLRDPSAAATIGLDRETCFDYHSSARQLERIGDHAAKIATHAETLSTP-PTDAA
914|gene|hut        SRVFRTVLRNPTAANDMGFPRETVFDYQSGARQLERIADHANKIADIATDIEA-VPEEEA
12150|gene|hma      SRVFRTVLRNPTAANEIGFPRETVFDFQSSARQLERIADHATKIASLSQEIGE-ITGETA
2632|gene|hhi       SRVFRTVLRNPTTADEIGFPRETVFDFQSSARQLERIADHATKIASLSQEIGE-ITGETA
11510|gene|hma      SRVFRTVLRNPTAANEIGFPRETVFDYQSSARQLERIADHATKIASLSQEIGE-ITGETA
2080|gene|hhi       SRVFRTVLRNPTAANEIGFPRETVFDYQSSARQLERIADHATKIASLSQEIGE-ITGETA
                    **:** .** *..*  :*: **  **::*.******:.*** **.  :  :    . :  

458|gene|nrc1       DALETLQADATDIIETAMDALFADTADEATALATQARAQVRDIDDQARDVDDRLHGL-TA
1545|gene|hla       EAVNELHGDAVEVIDTAMDALFADDSEEATRLANEARTGVRAIDERVRAIDELLRDL-DP
3308|gene|hwa       DSLMELCDEAQSIVDAAMDALFTADNNKVTDLANDARESVQQIDERARQIDELLRGL-DP
8050|gene|hbo       SALEELYMEARKVVDDGMDALFTDDPDEASRLANDARENVQQIDERARKIDELLRDL-DP
1976|gene|nph       DAIRDLHDEATEVVDMGMDALLEDDSDRATRLAHDARTRIANVDELTRRVDDEIREL-DP
914|gene|hut        DALDELREIAISVPETAMDALLADDPDEAVSLANEARGRIPEVDEKAREVDSLIRQFDDP
12150|gene|hma      ELLDQLEAEAIAVPETAMDALLTEDSDEAVELANGARSQIPDVDETAREVDGQIREF-DP
2632|gene|hhi       ELLDQLEAEAIAVPETAMDALLTEDSDEAVELANEARSQIPDVDGTAREVDGQIREF-DP
11510|gene|hma      DLLDQLETEAIAVPETAMDALLADDNDEAVELANEARSRIPEVDETAREVDGKVREL-DP
2080|gene|hhi       DLLDQLETEAIAVPETAMDALLADDNDEAVELANEARARIPEVDETAREVDGKVREL-DP
                    . :  *   *  : : .****:    : .  **  **  :  :*  .* :*  :. :  .

458|gene|nrc1       HHAQHLGLVVDSLSRSADYGGNIAETALQKAAPTPNP
1545|gene|hla       TRAQLLGLVVDSVLRSADYGGNVAETALQKAAPTP--
3308|gene|hwa       ARAQLLGLIVDSVSRSADYGGNIAETALQKAAPTP--
8050|gene|hbo       ARAQLLGLIVDSVSRSADYGGNIAETALQKAAPTP--
1976|gene|nph       QQAQLLGLVVDSLSRSADYGGNIAETALQNAAPKP--
914|gene|hut        QRAHRLGLVVDSLSRTADYGSNIAESALQKAVPRPA-
12150|gene|hma      QSAQVLGLIVDSLSRTADYGGNIAESALQKAAPRPQS
2632|gene|hhi       QSAQVLGLIVDSLSRTADYGGNIAESALQKAAPRPQS
11510|gene|hma      QSAQLLGRVVDSLSRTADYGGNIAESALQKAAPRP--
2080|gene|hhi       QSAQLLGRVVDSLSRTADYGGNIAESALQKAAPRP--
                      *: ** :***: *:****.*:**:***:*.* *