HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0001COG1695arCOG00005 arCOG00006 Predicted transcriptional regulators padR family transcriptional regulator

HOG Organism Gene ID Name Annotation
cHOG0001 nrc1 VNG0258 prlR1 padR family transcriptional regulator
cHOG0001 nrc1 VNG0751 prlR2 padR family transcriptional regulator
cHOG0001 nrc1 VNG1426 prlR3 padR family transcriptional regulator
cHOG0001 nrc1 VNG5050c vng5050 no entry
cHOG0001 nrc1 VNG5130c vng5130 no entry
cHOG0001 nrc1 VNG5144c prlR6 padR family transcriptional regulator
cHOG0001 nrc1 VNG5247c vng5247 no entry
cHOG0001 nrc1 VNG6048c prlR7 padR family transcriptional regulator
cHOG0001 nrc1 VNG6126c prlR8 padR family transcriptional regulator
cHOG0001 nrc1 VNG6478c vng6478 no entry
cHOG0001 hmu HMUK3064 Hmuk_3064 transcriptional regulator, PadR-like family
cHOG0001 hmu HMUK2947 Hmuk_2947 transcriptional regulator, PadR-like family
cHOG0001 hmu HMUK2749 Hmuk_2749 transcriptional regulator, PadR-like family
cHOG0001 hmu HMUK2210 Hmuk_2210 transcriptional regulator, PadR-like family
cHOG0001 hma RRNAC0435 transcription regulator
cHOG0001 hma RRNAC0992 DNA binding domain-containing protein
cHOG0001 hma RRNAC3322 transcription regulator
cHOG0001 hma RRNB0112b hypothetical protein
cHOG0001 hma RRNB0157b hypothetical protein
cHOG0001 hma RRNB0161b putative transcriptional regulator
cHOG0001 hma PNG2006b hypothetical protein
cHOG0001 hma PNG4042b DNA binding protein
cHOG0001 hma PNG5119b putative transcriptional regulator
cHOG0001 hma PNG5140b hypothetical protein
cHOG0001 hma PNG6058b hypothetical protein
cHOG0001 hma PNG6092b transcription regulator
cHOG0001 hwa HQ1230A padR transcription regulator
cHOG0001 hwa HQ2407A padR transcription regulator
cHOG0001 hla HLAC0305 Hlac_305 transcriptional regulator, PadR-like family
cHOG0001 hla HLAC2198 Hlac_2198 transcriptional regulator, PadR-like family
cHOG0001 hla HLAC3619b Hlac_3619 transcriptional regulator, PadR-like family
cHOG0001 hla HLAC3358b Hlac_3358 transcriptional regulator, PadR-like family
cHOG0001 hla HLAC3315b Hlac_3315 transcriptional regulator, PadR-like family
cHOG0001 hla HLAC3648b Hlac_3648 transcriptional regulator, PadR-like family
cHOG0001 hbo HBOR24850 Hbor_24850 transcriptional regulator, PadR family
cHOG0001 hbo HBOR13800 Hbor_13800 transcriptional regulator, PadR family
cHOG0001 hbo HBOR30360b Hbor_30360 transcriptional regulator, PadR family
cHOG0001 hbo HBOR34050b Hbor_34050 transcriptional regulator, PadR family
cHOG0001 hbo HBOR36580b Hbor_36580 transcriptional regulator, PadR family
cHOG0001 hut HUTA2941 Huta_2941 transcriptional regulator, PadR-like family
cHOG0001 hut HUTA1205 Huta_1205 transcriptional regulator, PadR-like family
cHOG0001 hvo HVO_0730 HVO_0730 transcription regulator
cHOG0001 nph NP2366A transcription regulator
cHOG0001 nph NP3002A transcription regulator
cHOG0001 hhi 1619 HAH_1619 PadR-like family transcriptional regulator/DNA binding domain-containing protein
cHOG0001 hhi 1198 HAH_1198 PadR-like family transcriptional regulator
cHOG0001 hhi 562 HAH_0562 transcription regulator
cHOG0001 hhi 4127 HAH_4127 PadR-like family transcriptional regulator
cHOG0001 hhi 4037 HAH_4037 DNA binding domain-containing protein
MUSCLE (3.6) multiple sequence alignment


10157|hp|hma        ----------------------------------MRLTPETVHEEYDWVQERGDDV----
10112|hp|hma        ----------------------------MWGRDNQCRVGRDDQVTITLAAVLGFLLVEIA
65140|hp|hma        ---------------------------------------MRPALRYIISVCVGLAV----
10161|gene|hma      -------------------------------MSDTRVRIYRHIESNPGVHFRELTR----
12006|hp|hma        MQIRVYDEGAVQDCLFVLGWGNRCRHRTVQWLIDQLTTAYRVHAVELPTHITDYRREWVG
2366|gene|nph       --------------------------MGSETTAGEARTDTDALPNKKPADLSKFQL----
5119|gene|hma       -----------------------------------------------MHDLNSFKR----
258|hp|nrc1         ------------------------------------MSEAQPDARSDARDLTAFQK----
1205|gene|hut       ----------------------------------MSEAQTEVVTPSIARELSAFQQ----
13322|gene|hma      ----------------------------------MSEAQTVTDSPGIAKELTAFQQ----
562|gene|hhi        ----------------------------------MSEAQTVTDSPGIAKELTAFQQ----
1230|gene|hwa       ----------------------------------MSEAQSITDGSSSVRDLTAFQQ----
305|gene|hla        --------------------------------MSEAQSVTDESTTQTASDLTAFQQ----
730|gene|hvo        ----------------------------------MSEAQTIGNESGAARDLTAFQQ----
24850|gene|hbo      -----------------------------------MSEAQTVNDSGLARDLTAFQQ----
3315|gene|hla       -----------------------------------------------MHELTGFQR----
3648|gene|hla       -----------------------------------------------MNELTGFQR----
4042|gene|hma       --------------------------------------------MTTYHDLTGFQR----
4037|gene|hhi       --------------------------------------------MTTYHDLTGFQR----
3619|gene|hla       ------------------------------------------MSQTQSFELTGFQR----
34050|gene|hbo      -----------------------------------------------MHELTGFQR----
36580|gene|hbo      -----------------------------------------------MFELTGFQR----
751|chp|nrc1        -----------------------------------------------MDDLTGFQR----
4127|gene|hhi       -----------------------------------------------MFDLTGFQR----
6058|hp|hma         -----------------------------------------------MHDLTGFQR----
6092|gene|hma       -------------------------------------MPPLKIENRRMHDLTGFQR----
5050|hp|nrc1        -----------------------------------------------MHDLTGFQR----
5247|hp|nrc1        -----------------------------------------------MHDLTGFQR----
6048|hp|nrc1        -----------------------------------------------MHDLTGFQR----
6478|hp|nrc1        -----------------------------------------------MHDLTGFQR----
1426|hp|nrc1        -----------------------------------------------MHDLTGFQR----
30360|gene|hbo      -----------------------------------------------MYDLTGFQR----
5130|hp|nrc1        --------------------------------------MFRVSELQRMQDLTGFQR----
6126|hp|nrc1        --------------------------------------MFRVSELQRMQDLTGFQR----
5144|hp|nrc1        -----------------------------------------------MHDLTGFQR----
2407|gene|hwa       -----------------------------------------------MYDLTGFQR----
3358|gene|hla       -----------------------------------------------MYDLTGFQR----
10435|gene|hma      -----------------------------------------------MYDLTGFQR----
1198|gene|hhi       -----------------------------------------------MYDLTGFQR----
2941|gene|hut       -----------------------------------------------MYDLTGFQR----
10992|gene|hma      -----------------------------------------------MHDLTGFQR----
1619|gene|hhi       -----------------------------------------------MHDLTGFQR----
3002|gene|nph       -----------------------------------------------MYDLTGFQR----
2198|gene|hla       -----------------------------------------------MYDLTGFQR----
13800|gene|hbo      -----------------------------------------------MYDLTGFQR----
                                                                                

10157|hp|hma        ------------VPLVNETRAYL-GSQF----GVDVDTLTD---DAYTA-----------
10112|hp|hma        TRTAISMAYVGGAFVAATVLIGP-TTPLGGVAGLIIHDGFHGTIGYWTAGTAAWVLAFAC
65140|hp|hma        --TALAVAFATADHL--IMLSLL--PLY----GAVTSLILAHKQQWVSL-----------
10161|gene|hma      -----ALDLATGQVQ--YHLSRL-DRVH----SESVNGRTH----YYTSSFDSWERHAIA
12006|hp|hma        PVQEYAADLGRFDLL-GHSAGGL-TAAHLDADGIGNRVYLS---PWWDS-----------
2366|gene|nph       ------------RIL--AVLADAGDAPK----GVTVKRRLQ---EYYSS-----------
5119|gene|hma       ------------DML--VVIAGM-DNPK----GTELTAELQ---EHYPE-----------
258|hp|nrc1         ------------NIL--TVLGE--EARY----GLAIKRELE---EYYGE-----------
1205|gene|hut       ------------NIL--VILAE--EARY----GLAVKRELE---TYYDS-----------
13322|gene|hma      ------------NIL--VILAE--EPRY----GLAIKRELE---EYYND-----------
562|gene|hhi        ------------NIL--VILAE--EPRY----GLAIKRELE---EYYDD-----------
1230|gene|hwa       ------------NIL--VILSE--EPMY----GLAIKRDLE---SYYGT-----------
305|gene|hla        ------------NIL--AILSE--EAMY----GLAIKRELE---SYYDS-----------
730|gene|hvo        ------------NIL--VILAE--EPMY----GLAIKRHLE---SYYDT-----------
24850|gene|hbo      ------------NIL--VILAE--EPMY----GLAIKRNLE---DYYQT-----------
3315|gene|hla       ------------DLL--YCVAAL-NEPS----GLEIGSELS---EYSST-----------
3648|gene|hla       ------------DLL--YCIAGT-DDPY----GLQIGRELE---NYTST-----------
4042|gene|hma       ------------DLL--EAIAAVEDDPY----GLALKDYLD---ERYAG-----------
4037|gene|hhi       ------------DLL--EAIAAVEDDPY----GLALKDYLD---ERYAE-----------
3619|gene|hla       ------------DLL--YVVAGS-DQPS----GQTVRREME---QYVD------------
34050|gene|hbo      ------------DLL--YLVAGL-EKPH----GLGIKRELE---QYYGE-----------
36580|gene|hbo      ------------DLL--YVIAGS-ERPS----GQEIKEKIG---KDVG------------
751|chp|nrc1        ------------DLL--VVAAGL-DTPN----GLDIKSDLE---TYYTG-----------
4127|gene|hhi       ------------DLL--YVVCGL-DGPH----GLAIKEEIE---EYYEG-----------
6058|hp|hma         ------------DVL--YVIAGL-EEPH----GLAVKAELD---DYYEQ-----------
6092|gene|hma       ------------DIL--YVTAGL-KEPH----GLAIKDELD---DYYEQ-----------
5050|hp|nrc1        ------------DIL--YVIADF-EEPH----GLALKDELE---VYYEQ-----------
5247|hp|nrc1        ------------DIL--YVIADF-EEPH----GLALKDELE---VYYEQ-----------
6048|hp|nrc1        ------------DIL--YVIADF-EEPH----GLALKDELE---VYYEQ-----------
6478|hp|nrc1        ------------DIL--YVIADF-EEPH----GLALKDELE---VYYEQ-----------
1426|hp|nrc1        ------------DLL--YVVAGL-DEPH----GLAIKDELE---QYYTS-----------
30360|gene|hbo      ------------DLL--MVIAGL-DEPH----GLAVKDELE---EYYET-----------
5130|hp|nrc1        ------------DLL--YVIAGL-DEPH----GLAVKAEME---EYYTS-----------
6126|hp|nrc1        ------------DLL--YVIAGL-DEPH----GLAVKAEME---EYYTS-----------
5144|hp|nrc1        ------------DLL--YAIAGL-DEPH----GLAVKDELE---NYYES-----------
2407|gene|hwa       ------------DLL--YVIAGL-EKPH----GLAIKDELE---SYYEK-----------
3358|gene|hla       ------------DLL--TVTAGI-EEPH----GLAIKDELE---DYYEK-----------
10435|gene|hma      ------------DLL--YVIAGL-DEPH----GLAIKEELE---NYYES-----------
1198|gene|hhi       ------------DLL--YVIAGL-DEPH----GLAIKEELE---NYYES-----------
2941|gene|hut       ------------DLL--YVIAGE-EEPH----GLAIKEELE---DYYEK-----------
10992|gene|hma      ------------DLL--YVIAGR-EEPH----GLAIKEELE---AYYEK-----------
1619|gene|hhi       ------------DLL--YVIAGR-EEPH----GLAIKEELE---AYYEK-----------
3002|gene|nph       ------------DLL--YVIAGR-EEPH----GLAIKEELE---DYYEK-----------
2198|gene|hla       ------------DLL--YVIAGL-DEPH----GLAIKEELE---DYYEK-----------
13800|gene|hbo      ------------DLL--YVIAGL-DEPH----GLAIKEELE---DYYEK-----------
                                                    .                           

10157|hp|hma        -------------------AIDEVFADGDRAVNVAALV----------------------
10112|hp|hma        GVVWLASGLSSGQERQGLKSMHRV-----------APAYAGIMLVSGVNATAFGAWLVMV
65140|hp|hma        -------------------SRRNPTRSTRKL----G------------------------
10161|gene|hma      FLRRETARDILLTLIER--ETARPDEVADHLDIARS------------------------
12006|hp|hma        -------------------DFPVP-----------GPVLDAIASLPIT------------
2366|gene|nph       -------------------DVNP------------G------------------------
5119|gene|hma       -------------------EITA------------G------------------------
258|hp|nrc1         -------------------EVNH------------G------------------------
1205|gene|hut       -------------------DVNH------------G------------------------
13322|gene|hma      -------------------EVNH------------G------------------------
562|gene|hhi        -------------------EVNH------------G------------------------
1230|gene|hwa       -------------------EVNH------------G------------------------
305|gene|hla        -------------------EVNH------------G------------------------
730|gene|hvo        -------------------EVNH------------G------------------------
24850|gene|hbo      -------------------EVNH------------G------------------------
3315|gene|hla       -------------------EVNH------------G------------------------
3648|gene|hla       -------------------EVNH------------G------------------------
4042|gene|hma       -------------------PINH------------S------------------------
4037|gene|hhi       -------------------PINH------------S------------------------
3619|gene|hla       -------------------NVNH------------G------------------------
34050|gene|hbo      -------------------SITQ------------G------------------------
36580|gene|hbo      -------------------EVNH------------G------------------------
751|chp|nrc1        -------------------NINH------------G------------------------
4127|gene|hhi       -------------------EIHH------------G------------------------
6058|hp|hma         -------------------EINH------------G------------------------
6092|gene|hma       -------------------EINH------------G------------------------
5050|hp|nrc1        -------------------EINH------------G------------------------
5247|hp|nrc1        -------------------EINH------------G------------------------
6048|hp|nrc1        -------------------EINH------------G------------------------
6478|hp|nrc1        -------------------EINH------------G------------------------
1426|hp|nrc1        -------------------EIHH------------G------------------------
30360|gene|hbo      -------------------KIHH------------G------------------------
5130|hp|nrc1        -------------------EIHH------------G------------------------
6126|hp|nrc1        -------------------EIHH------------G------------------------
5144|hp|nrc1        -------------------EIHH------------G------------------------
2407|gene|hwa       -------------------EIHH------------G------------------------
3358|gene|hla       -------------------EIHH------------G------------------------
10435|gene|hma      -------------------EVNH------------G------------------------
1198|gene|hhi       -------------------EVNH------------G------------------------
2941|gene|hut       -------------------EIHH------------G------------------------
10992|gene|hma      -------------------EIHH------------G------------------------
1619|gene|hhi       -------------------EIHH------------G------------------------
3002|gene|nph       -------------------EIHH------------G------------------------
2198|gene|hla       -------------------EIHH------------G------------------------
13800|gene|hbo      -------------------EIHH------------G------------------------
                                                       .                        

10157|hp|hma        ----RLLRGLDVTDDYP---------GFVVDELLGREL--------AAMI----------
10112|hp|hma        LGAQRFYTAVSGFLPGVIAAVGFSVFGLAAIGAV-KRL--------GSYV----------
65140|hp|hma        ----AIIGGLGAFTG-----------SLLLQASVPAGF--------AGYGLMLLGMAGAI
10161|gene|hma      ----TLEHHLRGLVEY----------DIVEKRRDSGRVTLALCRPDLTVELLAA------
12006|hp|hma        ----KPFIPIDTLDAD----------AIGDLATAQQLAEAPSSVSPAFLRTVFR------
2366|gene|nph       ----QLYPNLNELVET----------GFVAKGQKDKRT--------NAYEITND------
5119|gene|hma       ----RVYPQLDDLVEK----------GLVKKGKKNGRT--------NEYRLAGR------
258|hp|nrc1         ----RLYPNLDDLVNK----------GLVEKSELDKRT--------NEYALTNE------
1205|gene|hut       ----RLYPNLDDLVEM----------ELVEKSELDKRT--------NEYSLTEN------
13322|gene|hma      ----RLYPNLDDLVEM----------GLVEKSELDKRT--------NQYSLTES------
562|gene|hhi        ----RLYPNLDDLVEM----------GLVEKSELDKRT--------NQYSLTES------
1230|gene|hwa       ----RLYPNLDDLVES----------GLVTKSELDKRT--------NQYELTDE------
305|gene|hla        ----RLYPNLDDLVED----------GLVEKSELDKRT--------NQYELTEA------
730|gene|hvo        ----RLYPNLDDLVEM----------GLVEKSELDKRT--------NQYELTDD------
24850|gene|hbo      ----RLYPNLDDLVEM----------DLVEKSELDKRT--------NQYELTEK------
3315|gene|hla       ----RLYPNLNDLIEE----------GLLSKEEKDGRT--------NLYELTPL------
3648|gene|hla       ----RLYPNLNTLVEK----------GLVKKQSKDDRT--------NLYTLTDL------
4042|gene|hma       ----RLYQNLDQLVDS----------GLVSRDELDART--------NVYTLTDA------
4037|gene|hhi       ----RLYQNLDQLVDQ----------NLINRDELDART--------NVYTLTDA------
3619|gene|hla       ----RLYPNLDVLVEH----------SLVEKGSQDQRT--------NYYEVTES------
34050|gene|hbo      ----RLYPNLDALVED----------GYIKKGEKDRRT--------NFYELTAS------
36580|gene|hbo      ----RLYPNLDALVEE----------GLVDKGQQDRRT--------NYYTISES------
751|chp|nrc1        ----RLYPNLDTLVDK----------GLLEKTKADERT--------NHYLLTDR------
4127|gene|hhi       ----RLYPNLDTLVDK----------GLVEKAQKDRRT--------NIYSITRR------
6058|hp|hma         ----RLYPNLDDLVGK----------GLLEKGELDKRT--------NVYTVTQR------
6092|gene|hma       ----RLYPNLDDLVDK----------GLLEKGELDRRT--------NVYTVTQR------
5050|hp|nrc1        ----RLYPNLDDLVDK----------GLVEKGELDERT--------NSYTLTQR------
5247|hp|nrc1        ----RLYPNLDDLVDK----------GLVEKGELDERT--------NSYTLTQR------
6048|hp|nrc1        ----RLYPNLDDLVDK----------GLVEKGELDERT--------NSYTLTQR------
6478|hp|nrc1        ----RLYPNLDDLVDK----------GLVEKGELDERT--------NSYTLTQR------
1426|hp|nrc1        ----RLYPNLDTLVEK----------GLIDKGELDQRT--------NYYTLTHR------
30360|gene|hbo      ----RLYPNLDTLVEK----------GLIEKGTIDQRT--------NYYTTTRR------
5130|hp|nrc1        ----RLYPNLDTLVDK----------GLVEKGKLDQRT--------NSYALTRR------
6126|hp|nrc1        ----RLYPNLDTLVDK----------GLVEKGKLDQRT--------NSYALTRR------
5144|hp|nrc1        ----RLYPNLDTLVDK----------GLVEKGEIDQRT--------NSYALTRR------
2407|gene|hwa       ----RLYPNLDTLVEK----------GLIDKGELDRRT--------NYYSLTRR------
3358|gene|hla       ----RLYPNLDTLVEK----------GLVEKGEKDRRT--------NVYTVTKR------
10435|gene|hma      ----RLYPNLDTLVEK----------ALIEKGERDRRT--------NFYTLTKR------
1198|gene|hhi       ----RLYPNLDTLVEK----------ALIEKGERDRRT--------NFYTLTKR------
2941|gene|hut       ----RLYPNLDTLVDK----------GLVEKGQRDRRT--------NYYSLTRR------
10992|gene|hma      ----RLYPNLDTLVDK----------GLVEKGQRDRRT--------NFYTLTRR------
1619|gene|hhi       ----RLYPNLDTLVDK----------GLVEKGQRDRRT--------NFYTLTRR------
3002|gene|nph       ----RLYPNLDTLVEK----------GLVEKGQRDRRT--------NFYTLTRR------
2198|gene|hla       ----RLYPNLDTLVEK----------GLVEKGQRDRRT--------NYYTLTRR------
13800|gene|hbo      ----RLYPNLDTLVEK----------GLIEKGQRDRRT--------NYYTLTRR------
                             :                                                  

10157|hp|hma        AGEQ-PLRLLAEATFHLADVRTHGDDTAT-------------------------------
10112|hp|hma        GQTDTRGHSLFESESHRRNPEGPTTGTAIGVFFIGTVWLFGVSALDVFVHDLGLYPTASA
65140|hp|hma        ADSDQASS-----TDQATTSD---------------------------------------
10161|gene|hma      VEPTVSSRLS---GRFTRLLDRLFESE---------------------------------
12006|hp|hma        AQRSLPPARDTA-AAFCSLTDTVVDPRAV-------------------------------
2366|gene|nph       GQQALTSEVKWLAARTAGVAEEA-------------------------------------
5119|gene|hma       SVRDLQDHREWE-NQYLAPIDELSTWQAV-------------------------------
258|hp|nrc1         GFDAVVDDLEWTLSKFVADADRRERVETI-------------------------------
1205|gene|hut       GYDVLLEQLAWEFGKITTEEGRVDDIREL-------------------------------
13322|gene|hma      GKDAVLDQLGWVFGKFISDDGRADELRDL-------------------------------
562|gene|hhi        GKDAVLDQLGWVFGKFISDDGRADELRDL-------------------------------
1230|gene|hwa       GYDAVLDRLGWVFSKFVTDESRANRLLDL-------------------------------
305|gene|hla        GHDAVLGQLEWVLDRFVTDETRADEVRAL-------------------------------
730|gene|hvo        GLQAVLDRFDWMLAKFVTDDERAEMVSEL-------------------------------
24850|gene|hbo      GHDAVLNRFAWMLSKFVTDETRADEVREL-------------------------------
3315|gene|hla       GIELIEERQQWE-ADKLREAGIDLD-----------------------------------
3648|gene|hla       AIDHIEERRQWE-NDKLQHLNITADTE---------------------------------
4042|gene|hma       GQDTLYRQAETL-AGLCELPRPVTGGAQ--------------------------------
4037|gene|hhi       GRHKLQCHAETL-AGLCDHLRLTRGAQQ--------------------------------
3619|gene|hla       GEQLLTDRLKWE-NQYVSDLLEADQVTLA-------------------------------
34050|gene|hbo      GRQAILDRRAWENDTFGQLFE---------------------------------------
36580|gene|hbo      GRQAIRKRREWE-NQYVSLDE---------------------------------------
751|chp|nrc1        GKRELQSRREWE-DQYVPTPADDSDGHPT-------------------------------
4127|gene|hhi       GEREIAARNEWE-QQYRAGEPSG-------------------------------------
6058|hp|hma         GVREIEARREWE-SQYLEDVNAPTTS----------------------------------
6092|gene|hma       GQREIEARREWE-TQYLGTVDSGTA-----------------------------------
5050|hp|nrc1        GHREITARRDWE-QQYVDLSE---------------------------------------
5247|hp|nrc1        GHREITARRDWE-QQYVDLSE---------------------------------------
6048|hp|nrc1        GHREITARRDWE-QQYVDLSE---------------------------------------
6478|hp|nrc1        GHREITARRDWE-QQYVDLSE---------------------------------------
1426|hp|nrc1        GTRELEARREWE-TQYVGQS----------------------------------------
30360|gene|hbo      GRREINARQEWE-ERYLNA-----------------------------------------
5130|hp|nrc1        GQREIAARREWE-HQYVTLDE---------------------------------------
6126|hp|nrc1        GQREIAARREWE-HQYVTLDE---------------------------------------
5144|hp|nrc1        GRRELTARREWE-HQYVTLDE---------------------------------------
2407|gene|hwa       GQREIDARADWE-GSYIEISFEGFE-----------------------------------
3358|gene|hla       GQREIEARRKWE-NQYIDL-----------------------------------------
10435|gene|hma      GQRELDARKEWE-AQYVSA-----------------------------------------
1198|gene|hhi       GQRELDARKEWE-AQYVSA-----------------------------------------
2941|gene|hut       GRREIEARRDWE-GQYVDL-----------------------------------------
10992|gene|hma      GRREIDARREWE-DQYVDL-----------------------------------------
1619|gene|hhi       GRREIDARREWE-DQYVDL-----------------------------------------
3002|gene|nph       GRREIEARRDWE-DEYVDIE----------------------------------------
2198|gene|hla       GRREIDARTEWE-AQYVDH-----------------------------------------
13800|gene|hbo      GRREIKARKEWE-GDYIDIEYGGVRI----------------------------------
                                                                                

10157|hp|hma        --------------------------AGADDLDAALAAGVQTRVPGWPWQQTENPF----
10112|hp|hma        FRAFVNGLLGSGSPIATVGTTALLSVYNYGELAVVLSAPVALTAMLWWCTYHEQVLSSTV
65140|hp|hma        ------------------------------------------------------------
10161|gene|hma      ------------------------------------------------------------
12006|hp|hma        -------------------------------GERLPADRIRLYDGGHELFSSSGREDTAE
2366|gene|nph       ------------------------------------------------------------
5119|gene|hma       -------------------------------T----------------------------
258|hp|nrc1         -------------------------------VADD-------------------------
1205|gene|hut       -------------------------------LEDAA------------------------
13322|gene|hma      -------------------------------IAAQQ------------------------
562|gene|hhi        -------------------------------IAAQQ------------------------
1230|gene|hwa       -------------------------------VEEEL------------------------
305|gene|hla        -------------------------------LTE--------------------------
730|gene|hvo        -------------------------------VENKL------------------------
24850|gene|hbo      -------------------------------IDGNL------------------------
3315|gene|hla       ------------------------------------------------------------
3648|gene|hla       ------------------------------------------------------------
4042|gene|hma       ------------------------------------------------------------
4037|gene|hhi       ------------------------------------------------------------
3619|gene|hla       -------------------------------SSSSD------------------------
34050|gene|hbo      ------------------------------------------------------------
36580|gene|hbo      ------------------------------------------------------------
751|chp|nrc1        -------------------------------ARN--------------------------
4127|gene|hhi       ------------------------------------------------------------
6058|hp|hma         ------------------------------------------------------------
6092|gene|hma       ------------------------------------------------------------
5050|hp|nrc1        ------------------------------------------------------------
5247|hp|nrc1        ------------------------------------------------------------
6048|hp|nrc1        ------------------------------------------------------------
6478|hp|nrc1        ------------------------------------------------------------
1426|hp|nrc1        ------------------------------------------------------------
30360|gene|hbo      ------------------------------------------------------------
5130|hp|nrc1        ------------------------------------------------------------
6126|hp|nrc1        ------------------------------------------------------------
5144|hp|nrc1        ------------------------------------------------------------
2407|gene|hwa       ------------------------------------------------------------
3358|gene|hla       ------------------------------------------------------------
10435|gene|hma      ------------------------------------------------------------
1198|gene|hhi       ------------------------------------------------------------
2941|gene|hut       ------------------------------------------------------------
10992|gene|hma      ------------------------------------------------------------
1619|gene|hhi       ------------------------------------------------------------
3002|gene|nph       ------------------------------------------------------------
2198|gene|hla       ------------------------------------------------------------
13800|gene|hbo      ------------------------------------------------------------
                                                                                

10157|hp|hma        ----------AVE
10112|hp|hma        HGVGIISGGLSND
65140|hp|hma        -------------
10161|gene|hma      -------------
12006|hp|hma        TVIDTLQHGPDAL
2366|gene|nph       -------------
5119|gene|hma       -------------
258|hp|nrc1         -------------
1205|gene|hut       -------------
13322|gene|hma      -------------
562|gene|hhi        -------------
1230|gene|hwa       -------------
305|gene|hla        -------------
730|gene|hvo        -------------
24850|gene|hbo      -------------
3315|gene|hla       -------------
3648|gene|hla       -------------
4042|gene|hma       -------------
4037|gene|hhi       -------------
3619|gene|hla       -------------
34050|gene|hbo      -------------
36580|gene|hbo      -------------
751|chp|nrc1        -------------
4127|gene|hhi       -------------
6058|hp|hma         -------------
6092|gene|hma       -------------
5050|hp|nrc1        -------------
5247|hp|nrc1        -------------
6048|hp|nrc1        -------------
6478|hp|nrc1        -------------
1426|hp|nrc1        -------------
30360|gene|hbo      -------------
5130|hp|nrc1        -------------
6126|hp|nrc1        -------------
5144|hp|nrc1        -------------
2407|gene|hwa       -------------
3358|gene|hla       -------------
10435|gene|hma      -------------
1198|gene|hhi       -------------
2941|gene|hut       -------------
10992|gene|hma      -------------
1619|gene|hhi       -------------
3002|gene|nph       -------------
2198|gene|hla       -------------
13800|gene|hbo      -------------